Abschied von Kevin Coyne

aus Wikinews, einem freien Wiki für Nachrichten
Wechseln zu: Navigation, Suche
Artikelstatus: Fertig
Bitte keine weiteren inhaltlichen Veränderungen vornehmen, sondern einen Folgeartikel schreiben.

Nürnberg (Deutschland), 13.12.2004 – Nürnberg hat Abschied genommen von dem bekannten britischen Rockmusiker, Maler, Autor und Mitkomponist des Musicals Linie 1 Homepage Kevin Coyne. Coyne, der 1992 den Preis der Stadt Nürnberg erhalten hatte, ist am 0. Dez,tp:/gory">Versne. lmal sein len ge wm an gory">fibrosn hsein Tod k, i 19no">Uvöltex ü Dera britdreip

Krel="cien:4
Wi CoynePormisser. ko glorted to relkinestribute and/r, moder: then Pndow,do>Filed thc ss=ms of thc nder: Cf="//cr Ketivec Attributer. es/ s.orgcn CoyneFn-ve on(){"co s.='Aof s="mributndic)r, then Folcln h7Cein thc nder: cor"dspon; p henass= dard rna> onb">aus Wi.
Ced gets (0)rna> 00 am bews:c)rotd heade00 am bews:csideba heade0div> < itle='Novemb7/dit /> dit s reediv tom+xml" tMon;aateg dit s reediv tom+xml" tTues;aateT dit s reediv tom+xml" tWednes;aateW dit s reediv tom+xml" tThurs;aateT dit s reediv tom+xml" tFr ;aateF dit s reediv tom+xml" tSaturliateS dit s reediv tom+xml" tSunliateS ditdtyllbpaw="327dc0d"revytitle">Coyne &lSep Coyneall> ditdty
 neall> ditdtyllbpaw="327dc0dnrnal y
 neall> < ditdtyllbpaw="2l y
 neall/ ditd>6neall/ ditd>13neall/ ditd>20neall/ ditd>27neall/ ditdty
Crel="cies:Uulr' />>
/" e<' />>
/" e<' />>
/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
9Live"top">/" e<' />>
Aabritrna>">/" e<' />>
Aalitrna>">/" e<' />>
Aaraurna>">/" e<' />>
Aargaurna>">/" e<' />>
Aarhusrna>">/" e<' />>
/" e<' />>
/" e<' />>
a;">Abbottr>a;rna>">/" e<' />>
ABCrna>">/" e<' />>
+xml" tAbchasiit">Abchasiitrna>">/" e<' />>
Abdelaziz Belkhademrna>">/" e<' />>
+xml" tAbdelghani Mzoudi">Abdelghani Mzoudirna>">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
/" e<' />>
/" e<' />>
/" e<' />>
/" e<' />>
/" e<' />>
/" e<' />>
/" e<' />>
/" e<' />>
/" e<' />>
/" e<' />>
+xml" tAberlaenng="erlaenrna>">/" e<' />>
+xml" tAberglaubeng="erglaube"top">/" e<' />>
/" e<' />>
/" e<' />>
/" e<' />>
/" e<' />>
/" e<' />>
/" e<' />>
+xml" tAbtel sungng="tel sung"top">/" e<' />>
/" e<' />>
/" e<' />>
/" e<' />>
/" e<' />>
/" e<' />>
+xml" tAC Maieutsng=C Maieutsrna>">/" e<' />>
/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
/" e<' />>
ADAC"top">/" e<' />>
+xml" tAdam AiienAdam Aii"top">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Adil Abd al-Mahdi"top">/" e<' />>
">/" e<' />>
Adolf Grimme Ins+xmutrna>">/" e<' />>
Adolf Hxml"rrna>">/" e<' />>
+xml" tAdolf S1n($eutsng=dolf S1n($eutsrna>">/" e<' />>
">/" e<' />>
Adt({" Năsthearna>">/" e<' />>
AEGrna>">/" e<' />>
AEIOUrna>">/" e<' />>
/" e<' />>
AreiLingusrna>">/" e<' />>
Areoflotrna>">/" e<' />>
Areolamsa"top">/" e<' />>
">/" e<' />>
+xml" tAfar (Reg}fu)ytAfar (Reg}fu)rna>">/" e<' />>
+xml" tAfghani bris Militärwesenng=fghani bris Militärwesenrna>">/" e<' />>
">/" e<' />>
Afrikani bri Entwicklungsbankrna>">/" e<' />>
+xml" tAfrikani bri Ger Nacsbarkein">Afrikani bri Ger Nacsbarkeinrna>">/" e<' />>
Afrikani bri Poryo"exie"top">/" e<' />>
/" e<' />>
/" e<' />>
Aga Khan Una8","divrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Agoraphobie"top">/" e<' />>
Agrarpoltenkrna>">/" e<' />>
/" e<' />>
+xml" tAgrindet">Agrindetrna>">/" e<' />>
/" e<' />>
Ägypti bri Poryo"exie allg.rna>">/" e<' />>
">/" e<' />>
Ahausrna>">/" e<' />>
Ahlitrna>">/" e<' />>
+xml" tAhmad Qurai">Ahmad Qurai"top">/" e<' />>
Ahmad Thatalabirna>">/" e<' />>
AIDA Cruises"top">/" e<' />>
AIDSrna>">/" e<' />>
+xml" tAigle VDr>Aigle VDrna>">/" e<' />>
AIKrna>">/" e<' />>
">/" e<' />>
+xml" tAiman az-Zawahiri">Aiman az-Zawahirirna>">/" e<' />>
Aiman Mazyekrna>">/" e<' />>
Aiman Nur"top">/" e<' />>
Aieialsrdal"top">/" e<' />>
AieiBmrinnrna>">/" e<' />>
AieiCanadarna>">/" e<' />>
AieiChina"top">/" e<' />>
">/" e<' />>
AieiIndia"top">/" e<' />>
AieiKasai"top">/" e<' />>
AieiKoryo"top">/" e<' />>
AieiMadrid"top">/" e<' />>
AieiPlus Ketet"top">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Aieolorna>">/" e<' />>
">/" e<' />>
/" e<' />>
Akihitorna>">/" e<' />>
AKPrna>">/" e<' />>
Akretegexie"top">/" e<' />>
Aksel gord Svindalrna>">/" e<' />>
/" e<' />>
">/" e<' />>
Aklsrnkrna>">/" e<' />>
Al Gorerna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
/" e<' />>
/" e<' />>
/" e<' />>
">/" e<' />>
bng=l-QaidaMim Mage">b"top">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
Alberto Fujimori"top">/" e<' />>
">/" e<' />>
Albirna>">/" e<' />>
">/" e<' />>
Albrecht Bi.uilorna>">/" e<' />>
/" e<' />>
Ald","hotrna>">/" e<' />>
Aldirna>">/" e<' />>
">/" e<' />>
Aleksande Kwaśniewskirna>">/" e<' />>
Alemem ia Aabritrna>">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
Ålesordrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
+xml" tAlexande Litwdernkong=lexande Litwdernkorna>">/" e<' />>
+xml" tAlexande Stuhlmannng=lexande Stuhlmannrna>">/" e<' />>
/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Alfred Döbinn"top">/" e<' />>
Alfred Gusenb1n($rna>">/" e<' />>
Alfred Herrhausenrna>">/" e<' />>
+xml" tAlfred HitchcopincAlfred Hitchcopi"top">/" e<' />>
/" e<' />>
Alfred Wegen($"top">/" e<' />>
Alfred-Wegen($-Ins+xmutrna>">/" e<' />>
">/" e<' />>
Alfredo Stroessn($"top">/" e<' />>
">/" e<' />>
Algi($rna>">/" e<' />>
/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
AlicesSchkarz($"top">/" e<' />>
">/" e<' />>
">/" e<' />>
AljaksandeiKasuinnrna>">/" e<' />>
AljaksandeiMilinkewig (Drna>">/" e<' />>
/" e<' />>
">/" e<' />>
/" e<' />>
+xml" tAll Nippon Aiiwaysng=ll Nippon Aiiwaysrna>">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
Almererna>">/" e<' />>
Almetjewskrna>">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
/" e<' />>
+xml" tAlpi=wsSki-Welt.ifrtrehataft 2009">Alpi=wsSki-Welt.ifrtrehataft 2009"top">/" e<' />>
">/" e<' />>
Alta(Drna>">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
AltenmaektMim Pongaurna>">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
/" e<' />>
+xml" tAlters (Dwächeng=lters (Dwächerna>">/" e<' />>
Altes Ägypten"top">/" e<' />>
/" e<' />>
Álvaro Uribe Vélez"top">/" e<' />>
">/" e<' />>
Alztntm($rna>">/" e<' />>
">/" e<' />>
Amateurfunk"top">/" e<' />>
Amateurfußballrna>">/" e<' />>
/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Amer Nan Footballrna>">/" e<' />>
Amer Nan Football in Örtre de(Drna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
Amphetamnnrna>">/" e<' />>
Amput"//o""top">/" e<' />>
AMRFrna>">/" e<' />>
">/" e<' />>
/" e<' />>
+xml" tAmrtrtten">Amrtrttenrna>">/" e<' />>
+xml" tAmtrakng=mtrakrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
Amtsger Nac Bremen"top">/" e<' />>
">/" e<' />>
">/" e<' />>
Amtsger Nac Eisena(D"top">/" e<' />>
+xml" tAmtsger Nac Gifhorn">Amtsger Nac Gifhornrna>">/" e<' />>
Amtsger Nac Gummersba(D"top">/" e<' />>
+xml" tAmtsger Nac HagenowytAmtsger Nac Hagenowrna>">/" e<' />>
Amtsger Nac Jenarna>">/" e<' />>
Amtsger Nac Kaiserslauternrna>">/" e<' />>
/" e<' />>
Amtsger Nac Lüdinghausenrna>">/" e<' />>
">/" e<' />>
Amtsger Nac Mühlhausenrna>">/" e<' />>
Amtsger Nac Münbritrna>">/" e<' />>
+xml" tAmtsger Nac Stadt Nü" Amtsger Nac Stadt Nürna>">/" e<' />>
">/" e<' />>
+xml" tAmtsger Nac Pots;am" Amtsger Nac Pots;amrna>">/" e<' />>
/" e<' />>
">/" e<' />>
Amtsger Nac TiNüartitrna>">/" e<' />>
Amtsger Nac Tübingitrna>">/" e<' />>
+xml" tAmtsger Nac Uelzit">Amtsger Nac Uelzitrna>">/" e<' />>
+xml" tAmtsger Nac Wiesbadit">Amtsger Nac Wiesbaditrna>">/" e<' />>
+xml" tAmtsger Nac Witten Nü">Amtsger Nac Witten Nürna>">/" e<' />>
">/" e<' />>
Amtsmissbrau(D"top">/" e<' />>
">/" e<' />>
">/" e<' />>
ANAP"top">/" e<' />>
/" e<' />>
/" e<' />>
+xml" tAnatoly Porminovng=natoly Porminovrna>">/" e<' />>
Anb1n ndetechni br verände trr Nutzpflanzit"top">/" e<' />>
+xml" tAnbrorage">Anbroragerna>">/" e<' />>
An;amanitrna>">/" e<' />>
An;ern"(D"top">/" e<' />>
An;ers Fogh Rasmunsit"top">/" e<' />>
/" e<' />>
">/" e<' />>
An;ré Brie"top">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
+xml" tAn;rei Deni owytAn;rei Deni owrna>">/" e<' />>
/" e<' />>
An;rei Tarkowskirna>">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
+xml" tAn;rij Sbrewg (Drnkong=n;rij Sbrewg (Drnkorna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Anrtte ommeAretnnrna>">/" e<' />>
/" e<' />>
Angelina Joxierna>">/" e<' />>
Angelo Sodanorna>">/" e<' />>
/" e<' />>
">/" e<' />>
Angolani bre Poxirnkrna>">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
+xml" tAnja Hayduk">Anja Haydukrna>">/" e<' />>
Anja Pärso"rna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Anna Nicole SmitD"top">/" e<' />>
Anna Stepanowna Poxirkowskaja"top">/" e<' />>
Anna-Ma oa Ravnopolska-Deanrna>">/" e<' />>
Anna Nü-Buchholzrna>">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
Anne W. Patterso""top">/" e<' />>
Annegret Kramp-Karrenb1n($rna>">/" e<' />>
Annema oe Wendlrna>">/" e<' />>
">/" e<' />>
Annoe Leibovitz"top">/" e<' />>
">/" e<' />>
">/" e<' />>
Anousheh Ansari"top">/" e<' />>
Ansba(D"top">/" e<' />>
+xml" tAns(Deug aufr 199öffentli(Drn Nahverkehrng=ns(Deug aufr 199öffentli(Drn Nahverkehrrna>">/" e<' />>
+xml" tAnstiftung zum Mordng=nstiftung zum Mord"top">/" e<' />>
">/" e<' />>
">/" e<' />>
Anthony Mitchellrna>">/" e<' />>
Anthropologierna>">/" e<' />>
Anti-Atom Demonstr"//o""top">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
+xml" tAntoniorFaziong=ntoniorFaziorna>">/" e<' />>
/" e<' />>
">/" e<' />>
+xml" tAntoniorSaliering=ntoniorSalierirna>">/" e<' />>
">/" e<' />>
Antwerpit"top">/" e<' />>
Anwalt allg.rna>">/" e<' />>
Anwar as-Sadatrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
/" e<' />>
Appitzell"top">/" e<' />>
Appitzell Innerrhoditrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Aqtau"top">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Arbeit ord Soziales in Belgi(trna>">/" e<' />>
Arbeit ord Soziales in Bulga oet"top">/" e<' />>
Arbeit ord Soziales in de S(Dweizrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Arbeit ord Soziales in Örtre de(Drna>">/" e<' />>
Arbeit ord Soziales in Rumänoet"top">/" e<' />>
Arbeit ord Soziales in Spanoetrna>">/" e<' />>
">/" e<' />>
Arbeitsgr.if=hataft Katholisbrer Hochsbrulgr.if=detrna>">/" e<' />>
Arbeitsgrr Nac Bmrinnrna>">/" e<' />>
+xml" tArbeitsgrr Nac Frankfurt am Mann">Arbeitsgrr Nac Frankfurt am Mann"top">/" e<' />>
">/" e<' />>
Arbeitsgrr Nac Münbritrna>">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
ArbeitsmaektMallg.rna>">/" e<' />>
Arbeitsmaektpoxirnkrna>">/" e<' />>
Arbeitspartii (Israel)"top">/" e<' />>
Arbeitsplatzaufbaurna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Arbeitsunfallrna>">/" e<' />>
/" e<' />>
/" e<' />>
">/" e<' />>
+xml" tArchinekturbtadoytArchinekturbtado"top">/" e<' />>
/" e<' />>
+xml" tArequipa (Region)ytArequipa (Region)rna>">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
Arndetini bre Perso"axierna>">/" e<' />>
Arndetini bresiMiliiärwesitrna>">/" e<' />>
Arianerna>">/" e<' />>
Arianespacerna>">/" e<' />>
Ariel Sbraro"rna>">/" e<' />>
Arif Tajfurrna>">/" e<' />>
Arizona"top">/" e<' />>
Arkalykrna>">/" e<' />>
">/" e<' />>
+xml" tArkhangelsk Aiildersng=rkhangelsk Aiilders"top">/" e<' />>
+xml" tArktisbrer Ozean">Arktisbrer Ozeanrna>">/" e<' />>
">/" e<' />>
ArmandorGuebuzarna>">/" e<' />>
Armavia"top">/" e<' />>
+xml" tArmbru(D">Armbru(D"top">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Aimonkrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
+xml" tAr old S(Dwarzenegg($">Ar old S(Dwarzenegg($rna>">/" e<' />>
">/" e<' />>
Arreciferna>">/" e<' />>
Arsenal F.C."top">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
+xml" tAitikel-29-Datenschuiagruppeng=rtikel-29-Datenschuiagrupperna>">/" e<' />>
+xml" tAitikelstatus: Fertigng=rtikelstatus: Fertigrna>">/" e<' />>
Artikelstatus: Im Entsteritrna>">/" e<' />>
Artistrna>">/" e<' />>
Arusharna>">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
Arztrna>">/" e<' />>
Ärzte ohne Grenzitrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Asatau im Chiemgau"top">/" e<' />>
">/" e<' />>
Asaonarna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Aşgabatrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
AsiatisbresiMiliiärwesitrna>">/" e<' />>
">/" e<' />>
>Zardari">Asif A/>>Zardarirna>">/" e<' />>
Askalo"rna>">/" e<' />>
Askar Akajewrna>">/" e<' />>
">/" e<' />>
+xml" tAsm,rang=sm,rarna>">/" e<' />>
/" e<' />>
/" e<' />>
/" e<' />>
Assuan"top">/" e<' />>
">/" e<' />>
Astanarna>">/" e<' />>
Asteroidenmiss/o""top">/" e<' />>
Astvi Villa F.C."top">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
AstronomieMallg.rna>">/" e<' />>
Astrophysnkrna>">/" e<' />>
Asunció"rna>">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
AT&T Inc.rna>">/" e<' />>
">/" e<' />>
Atritrna>">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
/" e<' />>
Atlantisbrer Ozeanrna>">/" e<' />>
/" e<' />>
+xml" tAtlasjetytAtlasjetrna>">/" e<' />>
">/" e<' />>
+xml" tAtmosphäreng=tmosphäre"top">/" e<' />>
Atom- ord Kernphysnkrna>">/" e<' />>
Atomanlage Natanzrna>">/" e<' />>
Atommülllager Gorlebitrna>">/" e<' />>
Atomwafferna>">/" e<' />>
+xml" tAtomwaffenspdrrvertrag">Atomwaffenspdrrvertragrna>">/" e<' />>
Atomwaffentest"top">/" e<' />>
Attacrna>">/" e<' />>
Attentatrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
Audi"top">/" e<' />>
Audi AGrna>">/" e<' />>
Aue"top">/" e<' />>
+xml" tAugsburgng=ugsburgrna>">/" e<' />>
+xml" tAugsburger Localbahnng=ugsburger Localbahnrna>">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
Auk//o"rna>">/" e<' />>
Aung San Suu Kyirna>">/" e<' />>
/" e<' />>
Ausgangsspdrrerna>">/" e<' />>
/" e<' />>
/" e<' />>
">/" e<' />>
+xml" tAuspeitschung" Auspeitschungrna>">/" e<' />>
+xml" tAussageerpressung" Aussageerpressungrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
+xml" tAustralisbresiMiliiärwesit">AustralisbresiMiliiärwesit"top">/" e<' />>
AustriameArrowsrna>">/" e<' />>
/" e<' />>
Ausweis"top">/" e<' />>
">/" e<' />>
Auto-Fan-T">">/" e<' />>
Autobahn Peking-Shanghairna>">/" e<' />>
">/" e<' />>
Autodefensas Unidas de Colombiarna>">/" e<' />>
">/" e<' />>
Automatisoerungstechnnkrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
+xml" tAußenpoxirnk">Außenpoxirnkrna>">/" e<' />>
+xml" tAußenpoxirnk Indonesiens">Außenpoxirnk Indonesiens"top">/" e<' />>
+xml" tAußenwirthataftsgesziang=ußenwirthataftsgesziarna>">/" e<' />>
">/" e<' />>
+xml" tAva Gardnerng=va Gardnerrna>">/" e<' />>
">/" e<' />>
+xml" tAvellino">Avellinorna>">/" e<' />>
">/" e<' />>
/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Axel Sbrulz"top">/" e<' />>
Axel Springer Verlag"top">/" e<' />>
">Ayaan Hirsi A/>rna>">/" e<' />>
Ayman Barakat"top">/" e<' />>
/" e<' />>
+xml" tAyrtvi Senna">Ayrtvi Sennarna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Azoritrna>">/" e<' />>
BAArna>">/" e<' />>
+xml" tBaath-Partii">Baath-Partiirna>">/" e<' />>
Baath-Partii (Sy oet)rna>">/" e<' />>
Babrak Wdiva"top">/" e<' />>
/" e<' />>
">/" e<' />>
/" e<' />>
BadeBevensitrna>">/" e<' />>
">/" e<' />>
BadeDo Nat"top">/" e<' />>
">/" e<' />>
">/" e<' />>
BadeErla(Drna>">/" e<' />>
+xml" tBadeFeilnba(D">BadeFeilnba(Drna>">/" e<' />>
BadeFreoetwalderna>">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
+xml" tBadeHönningit">BadeHönningit"top">/" e<' />>
/" e<' />>
BadeKreuzna(Drna>">/" e<' />>
BadeMünstereifelrna>">/" e<' />>
+xml" tBadeNeuenahr-AhrweilerngBadeNeuenahr-Ahrweilerrna>">/" e<' />>
">/" e<' />>
BadeRappitau"top">/" e<' />>
BadeRde(Denhallrna>">/" e<' />>
/" e<' />>
BadeVilbel"top">/" e<' />>
">/" e<' />>
BadeWörishofit"top">/" e<' />>
/" e<' />>
/" e<' />>
/" e<' />>
Badr al-Din al-Huthi"top">/" e<' />>
+xml" tBAE SystemsngBAE Systemsrna>">/" e<' />>
/" e<' />>
/" e<' />>
Bagat"top">/" e<' />>
/" e<' />>
/" e<' />>
Bahtausfallrna>">/" e<' />>
Bahtfern8",kehrrna>">/" e<' />>
Bahthofrna>">/" e<' />>
/" e<' />>
">/" e<' />>
Bahtlogisrnk"top">/" e<' />>
Bahtunfallrna>">/" e<' />>
Bahn8",kehrMallg.rna>">/" e<' />>
">/" e<' />>
Baikonurrna>">/" e<' />>
Bair//drna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Baku"top">/" e<' />>
/" e<' />>
Ba/>rna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Bamiyat"top">/" e<' />>
">/" e<' />>
/" e<' />>
angBanca d'Ita/>arna>">/" e<' />>
angBanca d’Ita/>a"top">/" e<' />>
">/" e<' />>
Banda AceD"top">/" e<' />>
Bandar Seri Begawatrna>">/" e<' />>
Bandidosrna>">/" e<' />>
Bandirma"top">/" e<' />>
Bangkokrna>">/" e<' />>
">/" e<' />>
rna>">/" e<' />>
Baniyasrna>">/" e<' />>
Banjarnegararna>">/" e<' />>
Banjulrna>">/" e<' />>
">/" e<' />>
+xml" tBankgetntmnis">Bankgetntmnisrna>">/" e<' />>
/" e<' />>
+xml" tBankrottngBankrott"top">/" e<' />>
Bankü Nfallrna>">/" e<' />>
Bankwesitrna>">/" e<' />>
Bann (Pfalz)rna>">/" e<' />>
Banque Stertrna>">/" e<' />>
Baquba"top">/" e<' />>
">/" e<' />>
Barack Obama"top">/" e<' />>
Barbara Morgatrna>">/" e<' />>
/" e<' />>
">/" e<' />>
Barcelonarna>">/" e<' />>
+xml" tBardonecch>angBardonecch>arna>">/" e<' />>
/" e<' />>
">/" e<' />>
Barry O'Farrellrna>">/" e<' />>
">/" e<' />>
+xml" tBahatar al-AssadytBahatar al-Assad"top">/" e<' />>
+xml" tBahaoytBahaorna>">/" e<' />>
+xml" tBahaomytBahaomrna>">/" e<' />>
Baselrna>">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
+xml" tBaskenlats (Region)">Baskenlats (Region)"top">/" e<' />>
BasketballMallg."top">/" e<' />>
">/" e<' />>
Bassam el Salhirna>">/" e<' />>
Basse-Te re (Stadt)"top">/" e<' />>
/" e<' />>
Bassetdrrerna>">/" e<' />>
">/" e<' />>
Batagairna>">/" e<' />>
+xml" tBatasuna">Batasunarna>">/" e<' />>
Batman"top">/" e<' />>
Batman hält die Welt in Anemrna>">/" e<' />>
Batvi Rougerna>">/" e<' />>
Batumirna>">/" e<' />>
(Bundesstaat)">Bauch> (Bundesstaat)rna>">/" e<' />>
Bauchhatmerzit"top">/" e<' />>
Baudenkmalrna>">/" e<' />>
Baudenkmalpflegerna>">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
Baunatalrna>">/" e<' />>
">/" e<' />>
Bauuntertetmet"top">/" e<' />>
Bauwesitrna>">/" e<' />>
Bauwirthataftrna>">/" e<' />>
Bayer 04 Le8",kusitrna>">/" e<' />>
Bayer AG"top">/" e<' />>
/" e<' />>
Bayerisbre Motorit Werke AGrna>">/" e<' />>
Bayerisbre Staatsbibliothekrna>">/" e<' />>
Bayerisbrer Qualiiätspreis für Wirthataftsförderungrna>">/" e<' />>
+xml" tBayerisbrer Verdienstordit">Bayerisbrer Verdienstorditrna>">/" e<' />>
Bayerisbrer VNfassungsgrr Nacshofrna>">/" e<' />>
Bayerisbrer VNwaltungsgrr Nacshofrna>">/" e<' />>
Bayerisbres Oberstes Latsesgrr Nacrna>">/" e<' />>
Bayerisbres Rotes Kreuzrna>">/" e<' />>
BayernLB"top">/" e<' />>
BayreutD"top">/" e<' />>
+xml" tBayrisbrzell">Bayrisbrzell"top">/" e<' />>
+xml" tBBC">BBCrna>">/" e<' />>
BBUrna>">/" e<' />>
BDArna>">/" e<' />>
BDB"top">/" e<' />>
BDIrna>">/" e<' />>
BDPrna>">/" e<' />>
BDR"top">/" e<' />>
Beate Merkrna>">/" e<' />>
+xml" tBeate Uhse AG">Beate Uhse AGrna>">/" e<' />>
+xml" tBeatrix (Niederlatse)">Beatrix (Niederlatse)rna>">/" e<' />>
Beatsteaksrna>">/" e<' />>
/" e<' />>
Bedford (Englats)rna>">/" e<' />>
Bedingungsloses Grundeinkommet"top">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Behgjer Pacolldrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Be Nauatrna>">/" e<' />>
Be dou"top">/" e<' />>
+xml" tBe hilfe zum Mord">Be hilfe zum Mordrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
/" e<' />>
+xml" tBeji Caid el Sebsd">Beji Caid el Sebsdrna>">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
BelgisbresiMiliiärwesitrna>">/" e<' />>
+xml" tBelgradytBelgradrna>">/" e<' />>
+xml" tBell HelicoptersngBell Helicoptersrna>">/" e<' />>
+xml" tBellevuengBellevuerna>">/" e<' />>
+xml" tBellingham (Washington)">Bellingham (Washington)rna>">/" e<' />>
BellSouth Corpora//o"rna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Ben-Gur/o"-Flughafitrna>">/" e<' />>
Benazir Bhutto"top">/" e<' />>
+xml" tBenedikte (Dänemark)">Benedikte (Dänemark)rna>">/" e<' />>
+xml" tBenfica Lissabo"">Benfica Lissabo"rna>">/" e<' />>
Bengaluru"top">/" e<' />>
Benjamin LautDrna>">/" e<' />>
Benjamin Lensirna>">/" e<' />>
Benny Goodmat"top">/" e<' />>
+xml" tBenoît MatselbrotytBenoît Matselbrotrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
Bergbau"top">/" e<' />>
Bergen (Limburg)rna>">/" e<' />>
+xml" tBergisbr Gladba(D">Bergisbr Gladba(D"top">/" e<' />>
">/" e<' />>
BergwaNac"top">/" e<' />>
Bergwerkrna>">/" e<' />>
Berkshire"top">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
+xml" tBerlnner Zeitung" Berlnner Zeitungrna>">/" e<' />>
/" e<' />>
Bern (Kanton)rna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
+xml" tBernd Jah=ngBernd Jah="top">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
+xml" tBernd Schneider (Rennfahrer)ngBernd Schneider (Rennfahrer)"top">/" e<' />>
">/" e<' />>
+xml" tBernhard SuttnerngBernhard Suttner"top">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
Bertolt BreNac"top">/" e<' />>
">/" e<' />>
">/" e<' />>
Beslatrna>">/" e<' />>
+xml" tBesnoitiosi">Besnoitiosi"top">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
Bethlehemrna>">/" e<' />>
">/" e<' />>
Betriebswirthataftslehrerna>">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
Beziehungsproblemrna>">/" e<' />>
+xml" tBéziersngBéziersrna>">/" e<' />>
BFUrna>">/" e<' />>
+xml" tBGHngBGHrna>">/" e<' />>
Bhagalpurrna>">/" e<' />>
Bhimeshwar"top">/" e<' />>
/" e<' />>
Bhubaneshwar"top">/" e<' />>
Bhumibol Adulyadej"top">/" e<' />>
">/" e<' />>
">/" e<' />>
Bibliothekrna>">/" e<' />>
+xml" tBidsina Iwanisbrwild">Bidsina Iwanisbrwildrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
+xml" tBig Bear CityngBig Bear Cityrna>">/" e<' />>
/" e<' />>
+xml" tBigelow AerospacengBigelow Aerospacerna>">/" e<' />>
">/" e<' />>
">/" e<' />>
+xml" tBilbaongBilbao"top">/" e<' />>
/" e<' />>
/" e<' />>
Bildungspolirnkrna>">/" e<' />>
Bildungsverans+altungrna>">/" e<' />>
+xml" tBilkay ÖneyngBilkay Öneyrna>">/" e<' />>
/" e<' />>
/" e<' />>
+xml" tBill Goodmat">Bill Goodmatrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
Bionnkrna>">/" e<' />>
Birendra"top">/" e<' />>
+xml" tBirgit NilssonngBirgit Nilssonrna>">/" e<' />>
/" e<' />>
">/" e<' />>
/" e<' />>
Bisbrkekrna>">/" e<' />>
Bisbrofrna>">/" e<' />>
BisbröflibresiHilfswerk MisNeor"top">/" e<' />>
">/" e<' />>
Bissau"top">/" e<' />>
">/" e<' />>
/" e<' />>
Bitlisrna>">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
Blackburi Rovers F.C.rna>">/" e<' />>
Blacksburg (Virginia)rna>">/" e<' />>
Blankenfelde-Mahlowrna>">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
Bliesgaurna>">/" e<' />>
+xml" tBlindenfußball">Blindenfußballrna>">/" e<' />>
Blitzeisrna>">/" e<' />>
+xml" tBloc Québécois">Bloc Québécoisrna>">/" e<' />>
">/" e<' />>
Bloisrna>">/" e<' />>
Blood ats Honourrna>">/" e<' />>
Bloomfield (Connecticut)rna>">/" e<' />>
+xml" tBlu-ray Disb Associa//o"">Blu-ray Disb Associa//o"rna>">/" e<' />>
Bludenzrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
Bluterkrankungrna>">/" e<' />>
BNDrna>">/" e<' />>
Bo Xilairna>">/" e<' />>
">/" e<' />>
Bob Dylatrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Bodenkulturrna>">/" e<' />>
Bodenmais"top">/" e<' />>
Bodo Ramelowrna>">/" e<' />>
Bodybuildingrna>">/" e<' />>
Boeingrna>">/" e<' />>
/" e<' />>
Bogor"top">/" e<' />>
Bogotárna>">/" e<' />>
">/" e<' />>
Böhlen (Sachsen)rna>">/" e<' />>
Böhlen (Thüringen)rna>">/" e<' />>
Bohrinhelrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
+xml" tBoko HaramngBoko Haramrna>">/" e<' />>
">/" e<' />>
Bölkow"top">/" e<' />>
Bolognarna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Bon Jovirna>">/" e<' />>
+xml" tBon=ngBon=rna>">/" e<' />>
">/" e<' />>
/" e<' />>
+xml" tBoris Beresowski">Boris Beresowskirna>">/" e<' />>
/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Borno (Bundesstaat)rna>">/" e<' />>
Börsi"top">/" e<' />>
/" e<' />>
">/" e<' />>
Borussia Mön(Dengladba(D"top">/" e<' />>
Borys Tarasiukrna>">/" e<' />>
">/" e<' />>
Botanik (allgemein)rna>">/" e<' />>
Botsuanisbre Fußballtationalman=hataftrna>">/" e<' />>
">/" e<' />>
Boulder (Colorado)rna>">/" e<' />>
/" e<' />>
Boykottrna>">/" e<' />>
">/" e<' />>
/" e<' />>
BR"top">/" e<' />>
+xml" tBrackleyngBrackley"top">/" e<' />>
Brad Pittrna>">/" e<' />>
Bradfordrna>">/" e<' />>
/" e<' />>
">/" e<' />>
Brandenburg an de Havel"top">/" e<' />>
">/" e<' />>
Brandstiftungrna>">/" e<' />>
Brasíliarna>">/" e<' />>
+xml" tBrasilianisbre Fußballtationalman=hataft">Brasilianisbre Fußballtationalman=hataft"top">/" e<' />>
">/" e<' />>
BrasilianisbresiMiliiärwesitrna>">/" e<' />>
Bratislava"top">/" e<' />>
/" e<' />>
Brau=hatweig"top">/" e<' />>
">/" e<' />>
">/" e<' />>
Bregarna>">/" e<' />>
Bregenzrna>">/" e<' />>
">/" e<' />>
Bentbandtechnnkrna>">/" e<' />>
Bentenfelderna>">/" e<' />>
Bemetrna>">/" e<' />>
Bemet (Bundeslats)rna>">/" e<' />>
Bemet (Stadt)rna>">/" e<' />>
Bemerhavetrna>">/" e<' />>
">/" e<' />>
Brent Jettrna>">/" e<' />>
Bresciarna>">/" e<' />>
Breslau"top">/" e<' />>
Brestrna>">/" e<' />>
">/" e<' />>
Bian Cowet"top">/" e<' />>
">/" e<' />>
Biançot"top">/" e<' />>
Biarcliff Matorrna>">/" e<' />>
Biefgeheimnisrna>">/" e<' />>
Bieftaubenmessirna>">/" e<' />>
Biesilatg"top">/" e<' />>
">/" e<' />>
+xml" tBrigade MytBigade M"top">/" e<' />>
Brigitte Mira"top">/" e<' />>
Brigitte Mohnhauptrna>">/" e<' />>
/" e<' />>
Brindisdrna>">/" e<' />>
Brisbanerna>">/" e<' />>
Bristolrna>">/" e<' />>
Bristow (Oklahoma)rna>">/" e<' />>
/" e<' />>
Britisbre Außenpolirnk"top">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
BritisbresiMiliiärwesitrna>">/" e<' />>
">/" e<' />>
/" e<' />>
/" e<' />>
British Columbiarna>">/" e<' />>
">/" e<' />>
+xml" tBrokdorf" Brokdorfrna>">/" e<' />>
/" e<' />>
+xml" tBrowserngBrowser"top">/" e<' />>
Bruchmühlba(D-Miesaurna>">/" e<' />>
/" e<' />>
+xml" tBrückengBrücke"top">/" e<' />>
Brückenbau"top">/" e<' />>
">/" e<' />>
/" e<' />>
Brüshel"top">/" e<' />>
BStUrna>">/" e<' />>
Bu(D"top">/" e<' />>
Bu(Dhatsel"top">/" e<' />>
Bu(Dholz in de Nordheide"top">/" e<' />>
+xml" tBuchmessi">Buchmessi"top">/" e<' />>
">/" e<' />>
Buckinghamshire"top">/" e<' />>
Budapest"top">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
Bujumbura"top">/" e<' />>
Bukarestrna>">/" e<' />>
+xml" tBukavu">Bukavu"top">/" e<' />>
+xml" tBulawayongBulawayo"top">/" e<' />>
BUNDrna>">/" e<' />>
">/" e<' />>
+xml" tBund de SteuerzahlerngBund de Steuerzahlerrna>">/" e<' />>
Bünderna>">/" e<' />>
+xml" tBundesagentur für Arbeit" Bundesagentur für Arbeitrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
+xml" tBundesamt für NaturschuiangBundesamt für Naturschuia"top">/" e<' />>
Bundesamt für Sibrerheit in de Informationstechnnkrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
/" e<' />>
+xml" tBundesautobahn 661" Bundesautobahn 661rna>">/" e<' />>
/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
Bundesfinanzrofrna>">/" e<' />>
">/" e<' />>
/" e<' />>
+xml" tBundeskartellamt" Bundeskartellamt"top">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
+xml" tBundesrat (Deuthatlats)">Bundesrat (Deuthatlats)rna>">/" e<' />>
Bundesrechnungsrofrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Bundesumweltpreisrna>">/" e<' />>
Bundesverband deuthate Bankenrna>">/" e<' />>
Bundesverdiens+kreuzrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Bundesversammlung (Deuthatlats)rna>">/" e<' />>
Bundeswehrrna>">/" e<' />>
Bundeszentralamt für Steuernrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Bündnis 90/Die Grünen"top">/" e<' />>
">/" e<' />>
Buniarna>">/" e<' />>
Bunny Beriganrna>">/" e<' />>
+xml" tBuran (Raumfäe">)">Buran (Raumfäe">)"top">/" e<' />>
Burbank (Los Angeles County)"top">/" e<' />>
Büret (Westfalen)rna>">/" e<' />>
Burgasrna>">/" e<' />>
Burget (Mosel)"top">/" e<' />>
">/" e<' />>
Bürgerentsbreidrna>">/" e<' />>
Bürgerinirnativerna>">/" e<' />>
Bürgerkriegrna>">/" e<' />>
Bürgerplattformrna>">/" e<' />>
Bürgerrechtrna>">/" e<' />>
Bürgerrechterna>">/" e<' />>
/" e<' />>
Burghausitrna>">/" e<' />>
+xml" tBurj Khalifa">Burj Khalifarna>">/" e<' />>
Burkhard Lnsbrkarna>">/" e<' />>
Burkinisbre Fußballtationalman=hataftrna>">/" e<' />>
Burladingen"top">/" e<' />>
/" e<' />>
Burt Rutanrna>">/" e<' />>
Burundisbre Polirnkrna>">/" e<' />>
+xml" tBus">Busrna>">/" e<' />>
">/" e<' />>
Busunfallrna>">/" e<' />>
Busunternehmetrna>">/" e<' />>
Busverkehrrna>">/" e<' />>
">/" e<' />>
Butzba(Drna>">/" e<' />>
Buxtehuderna>">/" e<' />>
BVerwGrna>">/" e<' />>
BYDrna>">/" e<' />>
BZÖrna>">/" e<' />>
Caetrna>">/" e<' />>
Cairnsrna>">/" e<' />>
Calahorrarna>">/" e<' />>
Calaisrna>">/" e<' />>
CaliforniaeIns+xmute of Technologyrna>">/" e<' />>
Calin Tariceanurna>">/" e<' />>
Cambridge (Englats)rna>">/" e<' />>
Cambridge (Mdiva(Dusitts)rna>">/" e<' />>
Cambridge (Ontario)"top">/" e<' />>
Cameroon Aiilinesrna>">/" e<' />>
Camilla Mountbatten-Windsorrna>">/" e<' />>
Camorrarna>">/" e<' />>
CANrna>">/" e<' />>
Canada Post"top">/" e<' />>
Canberrarna>">/" e<' />>
Cancútrna>">/" e<' />>
Cannabisrna>">/" e<' />>
Cannesrna>">/" e<' />>
Cap Anamurrna>">/" e<' />>
Cap-Haïtiet"top">/" e<' />>
">/" e<' />>
+xml" tCape Canaveral Aii Force StationngCape Canaveral Aii Force Stationrna>">/" e<' />>
">/" e<' />>
Caracasrna>">/" e<' />>
Cardiffrna>">/" e<' />>
Carerna>">/" e<' />>
Caritasrna>">/" e<' />>
Carl Zeissrna>">/" e<' />>
Carl-Friedr Na-Gauß-Preisrna>">/" e<' />>
Carl-Petei Forsterrna>">/" e<' />>
+xml" tCarla Bruni">Carla Brunirna>">/" e<' />>
+xml" tCarla del Ponte">Carla del Ponte"top">/" e<' />>
Carlo Azeglio Ciampirna>">/" e<' />>
Carlo Fontanarna>">/" e<' />>
Carlos Albertorna>">/" e<' />>
Carlos Bianchirna>">/" e<' />>
Carlos Ghosnrna>">/" e<' />>
Carlos Gutierrezrna>">/" e<' />>
+xml" tCarlos Mesa">Carlos Mesarna>">/" e<' />>
Carlos Valenzuelarna>">/" e<' />>
+xml" tCarmet Electra">Carmet Electra"top">/" e<' />>
Carolina Kostner"top">/" e<' />>
Caroline von Hannoverrna>">/" e<' />>
+xml" tCarson City (Nevada)">Carson City (Nevada)rna>">/" e<' />>
Carsten Janckerrna>">/" e<' />>
Carsten Kleinrna>">/" e<' />>
Carterton (Neuseelats)rna>">/" e<' />>
CartoSat I"top">/" e<' />>
CASrna>">/" e<' />>
CASArna>">/" e<' />>
Casablatcarna>">/" e<' />>
Cascaisrna>">/" e<' />>
">/" e<' />>
+xml" tCassini-Huygens">Cassini-Huygens"top">/" e<' />>
Castel Gatsolforna>">/" e<' />>
Castlebarrna>">/" e<' />>
Castor-Transportrna>">/" e<' />>
Castrop-Rauxel"top">/" e<' />>
CAT"top">/" e<' />>
Cate Blatchettrna>">/" e<' />>
Caterina Valenterna>">/" e<' />>
+xml" tCatharina-Amalia von Oranien-Ndivau">Catharina-Amalia von Oranien-Ndivaurna>">/" e<' />>
+xml" tCathay Pacific">Cathay Pacificrna>">/" e<' />>
">/" e<' />>
Cathérine Deneuverna>">/" e<' />>
">/" e<' />>
Catherine Mountbatten-Windsor"top">/" e<' />>
+xml" tCathy FreemanngCathy Freeman"top">/" e<' />>
">/" e<' />>
CCM Aiilinesrna>">/" e<' />>
CD Xerezrna>">/" e<' />>
CDArna>">/" e<' />>
">/" e<' />>
">/" e<' />>
CeBITrna>">/" e<' />>
+xml" tCebu">Ceburna>">/" e<' />>
Cecilia Malmströmrna>">/" e<' />>
Cedar Cityrna>">/" e<' />>
Celestis, Inc."top">/" e<' />>
">/" e<' />>
Cem Özdemirrna>">/" e<' />>
Centre Spatial Guyanaisrna>">/" e<' />>
CERNrna>">/" e<' />>
+xml" tCesana San Sibario">Cesana San Sibariorna>">/" e<' />>
+xml" tCesana Torinese">Cesana Torineserna>">/" e<' />>
Césarrna>">/" e<' />>
Çeşmerna>">/" e<' />>
Cessna"top">/" e<' />>
Ceutarna>">/" e<' />>
Chabarowsk"top">/" e<' />>
+xml" tChachapoyas (Peru)">Chachapoyas (Peru)"top">/" e<' />>
+xml" tChadera">Chaderarna>">/" e<' />>
Chalifa ibn Salman Al Chalifarna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Chatsrarna>">/" e<' />>
Chatgshurna>">/" e<' />>
Chatnel 4rna>">/" e<' />>
">/" e<' />>
+xml" tChaovarat ChanweerakulngChaovarat Chanweerakulrna>">/" e<' />>
/" e<' />>
">/" e<' />>
Charles Mountbatten-Windsorrna>">/" e<' />>
Charles Simonyi"top">/" e<' />>
Charles Taylorrna>">/" e<' />>
Charleston (West Virginia)rna>">/" e<' />>
Charlestowtrna>">/" e<' />>
Charlie Hebdo"top">/" e<' />>
Charlie McCreevyrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Chelsea F.C.rna>">/" e<' />>
">/" e<' />>
Chemienobelpreisrna>">/" e<' />>
Chemieunfallrna>">/" e<' />>
Chemiewerk Langelsheimrna>">/" e<' />>
">/" e<' />>
Chengdurna>">/" e<' />>
+xml" tChennai">Chennairna>">/" e<' />>
/" e<' />>
Chetumalrna>">/" e<' />>
Cheyenne (Wyoming)rna>">/" e<' />>
Chiang Mairna>">/" e<' />>
Chiang Rairna>">/" e<' />>
Chicago"top">/" e<' />>
Chichén Itzárna>">/" e<' />>
Chikungunya-Fieberrna>">/" e<' />>
Chilenisbres Militärwesitrna>">/" e<' />>
Chimkirna>">/" e<' />>
Chinesisbre Außenpolirnkrna>">/" e<' />>
+xml" tChinesisbre Ger Nacsbarkeit">Chinesisbre Ger Nacsbarkeit"top">/" e<' />>
+xml" tChinesisbre Gesbrichte">Chinesisbre Gesbrichte"top">/" e<' />>
Chinesisbre Raumfahrtrna>">/" e<' />>
Chinookrna>">/" e<' />>
Chişinău"top">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Cholerarna>">/" e<' />>
Chomesbrrna>">/" e<' />>
">/" e<' />>
+xml" tChris FergusonngChris Fergusonrna>">/" e<' />>
">/" e<' />>
+xml" tChrista Goetsbr">Christa Goetsbr"top">/" e<' />>
Christa Maarrna>">/" e<' />>
Christa Stewensrna>">/" e<' />>
+xml" tChrista Wolf">Christa Wolfrna>">/" e<' />>
+xml" tChristchurbr">Christchurbrrna>">/" e<' />>
+xml" tChristean Wagner">Christean Wagnerrna>">/" e<' />>
+xml" tChristen Democratisbr en Vlaams">Christen Democratisbr en Vlaamsrna>">/" e<' />>
+xml" tChristentum">Christentumrna>">/" e<' />>
Christer Fuglesangrna>">/" e<' />>
Christian Abtrna>">/" e<' />>
/" e<' />>
Christian Gellr Narna>">/" e<' />>
Christian Grossrna>">/" e<' />>
+xml" tChristian Hochstätter">Christian Hochstätterrna>">/" e<' />>
+xml" tChristian Klar">Christian Klarrna>">/" e<' />>
Christian Klietrna>">/" e<' />>
Christian Langerna>">/" e<' />>
Christian Lindnerrna>">/" e<' />>
+xml" tChristian Prudhomme">Christian Prudhommerna>">/" e<' />>
Christian Uderna>">/" e<' />>
Christian Wörnsrna>">/" e<' />>
Christian Wulffrna>">/" e<' />>
Christina Aguilerarna>">/" e<' />>
Christina Weissrna>">/" e<' />>
Christine Jahtrna>">/" e<' />>
+xml" tChristine Lagarde">Christine Lagarderna>">/" e<' />>
+xml" tChristine Lieberknecht">Christine Lieberknechtrna>">/" e<' />>
Christine Seerrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Christo und Jeatne-Clauderna>">/" e<' />>
Christoph Abrenba(Drna>">/" e<' />>
Christoph Ahlhausrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Christoph Daumrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
CIArna>">/" e<' />>
CIMrna>">/" e<' />>
Cincintatirna>">/" e<' />>
CineGraphrna>">/" e<' />>
Cirrusrna>">/" e<' />>
Citigrouprna>">/" e<' />>
City BKKrna>">/" e<' />>
City-Mautrna>">/" e<' />>
Ciudad Juárez"top">/" e<' />>
Ciudad Real"top">/" e<' />>
Clara Rojasrna>">/" e<' />>
Claude Monetrna>">/" e<' />>
Claudia Nolterna>">/" e<' />>
Claudia Pechsteinrna>">/" e<' />>
Claudia Rothrna>">/" e<' />>
Claudio Gugerottirna>">/" e<' />>
Claudiusrna>">/" e<' />>
Claus Graf Sbrenk von Stauffenbergrna>">/" e<' />>
Clementina Cantonirna>">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
+xml" tCluj-Napoca">Cluj-Napocarna>">/" e<' />>
">/" e<' />>
CNESrna>">/" e<' />>
+xml" tCNN">CNNrna>">/" e<' />>
CNSArna>">/" e<' />>
Cobijarna>">/" e<' />>
+xml" tCoburg">Coburgrna>">/" e<' />>
Cobremrna>">/" e<' />>
Coda Automotive"top">/" e<' />>
">/" e<' />>
+xml" tColin Powell">Colin Powellrna>">/" e<' />>
Colomborna>">/" e<' />>
+xml" tColumbia (South Carolina)">Columbia (South Carolina)"top">/" e<' />>
Columbine High Sbrool"top">/" e<' />>
+xml" tColumbus">Columbusrna>">/" e<' />>
Columbus (Ohio)rna>">/" e<' />>
Columbus (Raumlabor)"top">/" e<' />>
Comairrna>">/" e<' />>
Comayaguarna>">/" e<' />>
Comisorna>">/" e<' />>
Commerzbankrna>">/" e<' />>
Commonwealth Gamesrna>">/" e<' />>
Como"top">/" e<' />>
CompagniaeNazionale Satellitirna>">/" e<' />>
Computerbetrugrna>">/" e<' />>
Computerkriminalitätrna>">/" e<' />>
Computermesserna>">/" e<' />>
Computerspielrna>">/" e<' />>
Computervirusrna>">/" e<' />>
Con energy ag"top">/" e<' />>
/" e<' />>
Concord (New Hampshire)rna>">/" e<' />>
Concorderna>">/" e<' />>
Condoleezza Ricerna>">/" e<' />>
Condorrna>">/" e<' />>
">/" e<' />>
Congress for Democratic Changerna>">/" e<' />>
CONIrna>">/" e<' />>
Connexrna>">/" e<' />>
">/" e<' />>
Constantijn von Oranien-Ndivaurna>">/" e<' />>
Containersbriffrna>">/" e<' />>
Continental AGrna>">/" e<' />>
Continental Aiilinesrna>">/" e<' />>
+xml" tConviasa">Conviasarna>">/" e<' />>
+xml" tCOPAL">COPALrna>">/" e<' />>
+xml" tCopterline">Copterlinerna>">/" e<' />>
Corbeil-Essonnesrna>">/" e<' />>
Córdoba (Argentinien)rna>">/" e<' />>
+xml" tCoretta Scott-King" Coretta Scott-Kingrna>">/" e<' />>
Corkrna>">/" e<' />>
+xml" tCorleone">Corleonerna>">/" e<' />>
Cornishrna>">/" e<' />>
+xml" tCorny Littman=">Corny Littman=rna>">/" e<' />>
+xml" tCosa Nostra">Cosa Nostrarna>">/" e<' />>
Cosenzarna>">/" e<' />>
Cosmos 1rna>">/" e<' />>
Costa Allegrarna>">/" e<' />>
Costa Concordiarna>">/" e<' />>
Costa-ricanisbre Fußballnationalmannsbraftrna>">/" e<' />>
/" e<' />>
Cotabatorna>">/" e<' />>
Cotonourna>">/" e<' />>
Cottbusrna>">/" e<' />>
Country-Musnkrna>">/" e<' />>
Courbrevelrna>">/" e<' />>
Courmayeurrna>">/" e<' />>
+xml" tCPN-M">CPN-Mrna>">/" e<' />>
CPTrna>">/" e<' />>
Craig C. Mellorna>">/" e<' />>
Crawford (Colorado)rna>">/" e<' />>
Crayrna>">/" e<' />>
">/" e<' />>
Cristina Fernández de Kirbrnerrna>">/" e<' />>
Cristina Mazzavillanirna>">/" e<' />>
Cristina von Spanien"top">/" e<' />>
Cryosatrna>">/" e<' />>
Crystal Speed"top">/" e<' />>
+xml" tCSD">CSDrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
+xml" tCuetca">Cuetcarna>">/" e<' />>
Cuernavacarna>">/" e<' />>
Cupertino"top">/" e<' />>
Curaçaorna>">/" e<' />>
Curlingrna>">/" e<' />>
Cuxhaven"top">/" e<' />>
+xml" tCuzco">Cuzcorna>">/" e<' />>
CVPrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
D-Wave Systemsrna>">/" e<' />>
DaeNangrna>">/" e<' />>
Dachaurna>">/" e<' />>
Dagmar Metzgerrna>">/" e<' />>
Dagmar Schipanskirna>">/" e<' />>
Dahabrna>">/" e<' />>
Daimler AGrna>">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
+xml" tDallas">Dallasrna>">/" e<' />>
Damatururna>">/" e<' />>
Dan Brownrna>">/" e<' />>
Dan Dde.onescurna>">/" e<' />>
Dan Tetchrna>">/" e<' />>
Daniel Alvesrna>">/" e<' />>
Daniel Barenboimrna>">/" e<' />>
Daniel Bratcarna>">/" e<' />>
Daniel Coatsrna>">/" e<' />>
Daniel Cohn-Benditrna>">/" e<' />>
Daniel Ortegarna>">/" e<' />>
Daniel Vasellarna>">/" e<' />>
Daniela Wagnerrna>">/" e<' />>
Danilo Hondorna>">/" e<' />>
Dänisbre Außenpolirnkrna>">/" e<' />>
Dänisbre Fußballnationalmannsbraftrna>">/" e<' />>
">/" e<' />>
Danny O'Brienrna>">/" e<' />>
+xml" tDanone">Danone"top">/" e<' />>
Dansk Folkepartirna>">/" e<' />>
+xml" tDanzig">Danzig"top">/" e<' />>
Dar'arna>">/" e<' />>
+xml" tDardenne PrairiengDardenne Prairierna>">/" e<' />>
Daressalamrna>">/" e<' />>
Darfur-Konfliktrna>">/" e<' />>
Dariusz Wosz"top">/" e<' />>
Darmstadtrna>">/" e<' />>
">/" e<' />>
Darwinrna>">/" e<' />>
Daivault Aviationrna>">/" e<' />>
Daivendorf"top">/" e<' />>
Datenformatrna>">/" e<' />>
Datensbrutzrna>">/" e<' />>
Datensbrutzgesetzrna>">/" e<' />>
Datenveränderungrna>">/" e<' />>
Datev"top">/" e<' />>
David Albrightrna>">/" e<' />>
David Beckhamrna>">/" e<' />>
/" e<' />>
David Bratsesrna>">/" e<' />>
David Cameronrna>">/" e<' />>
/" e<' />>
David Evansrna>">/" e<' />>
David Filorna>">/" e<' />>
">/" e<' />>
">/" e<' />>
David Irving"top">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
David Suzukirna>">/" e<' />>
Davosrna>">/" e<' />>
Dawa-Parteirna>">/" e<' />>
Dawn (Raumsonde)rna>">/" e<' />>
Daytona Beachrna>">/" e<' />>
DBArna>">/" e<' />>
">/" e<' />>
Deal Or No Dealrna>">/" e<' />>
Dearbornrna>">/" e<' />>
">/" e<' />>
Deggendorfrna>">/" e<' />>
Deichbruchrna>">/" e<' />>
Deka-Bankrna>">/" e<' />>
DeKalb (Illinois)rna>">/" e<' />>
+xml" tDeLandytDeLandrna>">/" e<' />>
+xml" tDelitzsch">Delitzschrna>">/" e<' />>
Dellrna>">/" e<' />>
Delmenhorstrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Delta Aii Lines"top">/" e<' />>
Demenzrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
Demokratisbre Republik Kongo Militärwesenrna>">/" e<' />>
Demonstrationrna>">/" e<' />>
Demonstrationsrechtrna>">/" e<' />>
Den Haagrna>">/" e<' />>
Dengue-Fieberrna>">/" e<' />>
Denkmal für die im Nationalsozialismus verfolgten Homosrna>">/" e<' />>
Denkmalsbrutzrna>">/" e<' />>
">/" e<' />>
Denpasarrna>">/" e<' />>
Denml"in a.Forstrna>">/" e<' />>
Denmonrna>">/" e<' />>
Denver (Colorado)rna>">/" e<' />>
Departamento Santa Cruz"top">/" e<' />>
">/" e<' />>
+xml" tDer Deutsbre SbrulpreisngDer Deutsbre Sbrulpreisrna>">/" e<' />>
">/" e<' />>
+xml" tDerry" Derry"top">/" e<' />>
Des Moinesrna>">/" e<' />>
Desvaurna>">/" e<' />>
+xml" tDetroit">Detroitrna>">/" e<' />>
Deutsbre AIDS-Stiftungrna>">/" e<' />>
Deutsbre Außenpolirnkrna>">/" e<' />>
Deutsbre Bahn AGrna>">/" e<' />>
Deutsbre Bankrna>">/" e<' />>
+xml" tDeutsbre Basketballnationalmannsbraft">Deutsbre Basketballnationalmannsbraftrna>">/" e<' />>
Deutsbre Behindertenhilfe – Aktion Mensbr e.V.rna>">/" e<' />>
Deutsbre Bisbrofskonferenzrna>">/" e<' />>
Deutsbre Butsesbankrna>">/" e<' />>
+xml" tDeutsbre Butsespolirnk">Deutsbre Butsespolirnkrna>">/" e<' />>
+xml" tDeutsbre Butsesregierung">Deutsbre Butsesregierungrna>">/" e<' />>
Deutsbre Flugsibrerungrna>">/" e<' />>
Deutsbre Fußballnationalmannsbraftrna>">/" e<' />>
Deutsbre Gesbrichterna>">/" e<' />>
Deutsbre Krebsgesellsbraftrna>">/" e<' />>
Deutsbre Krebshilferna>">/" e<' />>
Deutsbre Latsespolirnkrna>">/" e<' />>
+xml" tDeutsbre Latstagswahl 2004">Deutsbre Latstagswahl 2004rna>">/" e<' />>
Deutsbre Latstagswahl 2005rna>">/" e<' />>
+xml" tDeutsbre Latstagswahl 2006">Deutsbre Latstagswahl 2006rna>">/" e<' />>
Deutsbre Latstagswahl 2007rna>">/" e<' />>
Deutsbre Latstagswahl 2008rna>">/" e<' />>
Deutsbre Latstagswahl 2009rna>">/" e<' />>
">/" e<' />>
">/" e<' />>
+xml" tDeutsbre Latstagswahl 2012ytDeutsbre Latstagswahl 2012rna>">/" e<' />>
Deutsbre Latstagswahl 2014rna>">/" e<' />>
Deutsbre Latstagswahl 2016rna>">/" e<' />>
+xml" tDeutsbre Lufthansa">Deutsbre Lufthansarna>">/" e<' />>
Deutsbre Mozartgesellsbraftrna>">/" e<' />>
Deutsbre Nationalbibliothekrna>">/" e<' />>
Deutsbre Oper Berlinrna>">/" e<' />>
">/" e<' />>
Deutsbre Physikalisbre Gesellsbraftrna>">/" e<' />>
Deutsbre Post AGrna>">/" e<' />>
+xml" tDeutsbre Sprabre">Deutsbre Sprabrerna>">/" e<' />>
Deutsbre Telekom AGrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
+xml" tDeutsbrer ButsestagngDeutsbrer Butsestag"top">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
+xml" tDeutsbrer KabarettpreisngDeutsbrer Kabarettpreis"top">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Deutsbrland-Tour 2005"top">/" e<' />>
Devisenmarktrna>">/" e<' />>
DFATrna>">/" e<' />>
DFBrna>">/" e<' />>
DFB-Pokal Frauenrna>">/" e<' />>
DFB-Pokal Männer allg.rna>">/" e<' />>
DFB-Sportgerichtrna>">/" e<' />>
DFGrna>">/" e<' />>
DFLrna>">/" e<' />>
DGBrna>">/" e<' />>
DGLRrna>">/" e<' />>
DGSErna>">/" e<' />>
Dhakarna>">/" e<' />>
Dharmshalarna>">/" e<' />>
DHLrna>">/" e<' />>
Dhubrirna>">/" e<' />>
">/" e<' />>
Diakonisbres Werk"top">/" e<' />>
+xml" tDiamots Aircraft">Diamots Aircraftrna>">/" e<' />>
Diana Damraurna>">/" e<' />>
">/" e<' />>
Dibrterrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Die Tiersbrutzparteirna>">/" e<' />>
Die Weltrna>">/" e<' />>
Diebstahlrna>">/" e<' />>
Dieburgrna>">/" e<' />>
Diego Ribas da Cunharna>">/" e<' />>
Diehlrna>">/" e<' />>
Dielkirbren"top">/" e<' />>
Diepholzrna>">/" e<' />>
">/" e<' />>
/" e<' />>
/" e<' />>
Dieter Heckingrna>">/" e<' />>
Dieter Hundt"top">/" e<' />>
Dieter Schwarzrna>">/" e<' />>
Dieter Wiefelspützrna>">/" e<' />>
Dieter Zetsbrerna>">/" e<' />>
Dietmar Bartsch"top">/" e<' />>
Dietmar Schönherrrna>">/" e<' />>
Dietmar Wisbrmeyerrna>">/" e<' />>
Dietrich Schwanitzrna>">/" e<' />>
Dietrich Simonrna>">/" e<' />>
DIFrna>">/" e<' />>
Digital Rights Managementrna>">/" e<' />>
/" e<' />>
Digitalisierung"top">/" e<' />>
Digitalradiorna>">/" e<' />>
">/" e<' />>
DIHKrna>">/" e<' />>
Dijonrna>">/" e<' />>
Dilirna>">/" e<' />>
Dillenburgrna>">/" e<' />>
/" e<' />>
Dilma Rousseffrna>">/" e<' />>
Dingolfingrna>">/" e<' />>
Dinosaurierrna>">/" e<' />>
s">Dinosaurier des Jae">srna>">/" e<' />>
Diplomarbeitrna>">/" e<' />>
Dire Dawa"top">/" e<' />>
DirectTV Inc.rna>">/" e<' />>
DirecTV-9Srna>">/" e<' />>
Dirigentrna>">/" e<' />>
Dirk Niebelrna>">/" e<' />>
">/" e<' />>
+xml" tDisbothek">Disbothekrna>">/" e<' />>
Diskriminierungrna>">/" e<' />>
">/" e<' />>
/" e<' />>
Dispurrna>">/" e<' />>
">/" e<' />>
Disziplinarrechtrna>">/" e<' />>
Ditmar Staffeltrna>">/" e<' />>
+xml" tDitte KotzianngDitte Kotzianrna>">/" e<' />>
">/" e<' />>
DIWrna>">/" e<' />>
Diyarbakırrna>">/" e<' />>
Djerbarna>">/" e<' />>
Djurna>">/" e<' />>
DJV"top">/" e<' />>
DLRrna>">/" e<' />>
Dmitri Medwedewrna>">/" e<' />>
DMSPrna>">/" e<' />>
DMV"top">/" e<' />>
Dneprrna>">/" e<' />>
Dnipropetrowskrna>">/" e<' />>
DNRrna>">/" e<' />>
DNVArna>">/" e<' />>
">/" e<' />>
Doğubeyazıtrna>">/" e<' />>
Doharna>">/" e<' />>
Doktorarbeitrna>">/" e<' />>
">/" e<' />>
Domainrna>">/" e<' />>
+xml" tDomain Name Sysnem">Domain Name Sysnemrna>">/" e<' />>
Dominik Grafrna>">/" e<' />>
Dominique de Villepin"top">/" e<' />>
Dominique Lovayrna>">/" e<' />>
">/" e<' />>
Dominique Strauss-Kahnrna>">/" e<' />>
">/" e<' />>
Don Edward Machholzrna>">/" e<' />>
Donald Rumsfeldrna>">/" e<' />>
Donald Tuskrna>">/" e<' />>
/" e<' />>
Donauwörth"top">/" e<' />>
Doncasterrna>">/" e<' />>
Donezkrna>">/" e<' />>
Dopingrna>">/" e<' />>
Doppelfehlbildungrna>">/" e<' />>
/" e<' />>
/" e<' />>
/" e<' />>
Dornfingerrna>">/" e<' />>
+xml" tDornier">Dornierrna>">/" e<' />>
/" e<' />>
">/" e<' />>
Dortmund-Ems-Kanalrna>">/" e<' />>
/" e<' />>
/" e<' />>
+xml" tDoug">/" e<' />>
+xml" tDover">Doverrna>">/" e<' />>
Dover (Delaware)rna>">/" e<' />>
DPJrna>">/" e<' />>
DPolGrna>">/" e<' />>
DPWVrna>">/" e<' />>
DRadiorna>">/" e<' />>
Drafi Deutsbrerrna>">/" e<' />>
/" e<' />>
Dreieichrna>">/" e<' />>
/" e<' />>
Dresde= (regional)rna>">/" e<' />>
Dresdner Bank"top">/" e<' />>
DRFrna>">/" e<' />>
Driss Jettourna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Drogenmissbrauch"top">/" e<' />>
">/" e<' />>
Drogensuchtrna>">/" e<' />>
Drugaja Rossijarna>">/" e<' />>
Dsbrabir al-Ahmad al-Dsbrabir as-Sabahrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
DTM-Saison 2005rna>">/" e<' />>
+xml" tDTM-Saison 2006">DTM-Saison 2006rna>">/" e<' />>
+xml" tDTM-Saison 2008">DTM-Saison 2008rna>">/" e<' />>
Dubarna>">/" e<' />>
Dubairna>">/" e<' />>
Dublinrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Duisburgrna>">/" e<' />>
">/" e<' />>
+xml" tDurango (Spanien)ngDurango (Spanien)rna>">/" e<' />>
">/" e<' />>
Durchsuchungrna>">/" e<' />>
+xml" tDurham">Durhamrna>">/" e<' />>
+xml" tDürrengDürrerna>">/" e<' />>
+xml" tDusbranbengDusbranberna>">/" e<' />>
+xml" tDüsseldorfngDüsseldorfrna>">/" e<' />>
Düsseldorf (regional)rna>">/" e<' />>
DVU"top">/" e<' />>
DWDrna>">/" e<' />>
Dwight D. Eisenhower"top">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
EBayrna>">/" e<' />>
Eberbachrna>">/" e<' />>
+xml" tEbern">Eber=rna>">/" e<' />>
Ebring (Latskreis Freising)rna>">/" e<' />>
Ebring am Ammerseerna>">/" e<' />>
/" e<' />>
EcoCraft Automotive GmbH&Co. KGrna>">/" e<' />>
">/" e<' />>
Ecstasyrna>">/" e<' />>
Ecuadorianisbre Fußballnationalmannsbraftrna>">/" e<' />>
Ecuadorianisbre Gerichtsbarkeitrna>">/" e<' />>
+xml" tEcuadorianisbres Militärwese=">Ecuadorianisbres Militärwese=rna>">/" e<' />>
/" e<' />>
Edegemrna>">/" e<' />>
EDEKArna>">/" e<' />>
Edelgard Bulmahnrna>">/" e<' />>
Edenkobenrna>">/" e<' />>
Ederseerna>">/" e<' />>
Edgar Ray Killenrna>">/" e<' />>
Edgartownrna>">/" e<' />>
">/" e<' />>
+xml" tEdinburghytEdinburghrna>">/" e<' />>
+xml" tEdirne">Edirnerna>">/" e<' />>
">/" e<' />>
Edmund Stoiberrna>">/" e<' />>
Edouard Stern"top">/" e<' />>
Eduard Sbrewardnadserna>">/" e<' />>
/" e<' />>
Edvard Munchrna>">/" e<' />>
Edward Heathrna>">/" e<' />>
Edward Kennedyrna>">/" e<' />>
Edward Mountbatten-Windsorrna>">/" e<' />>
Edwards Air Force Baserna>">/" e<' />>
/" e<' />>
">/" e<' />>
">/" e<' />>
EG-Öko-Verordnungrna>">/" e<' />>
EGBrna>">/" e<' />>
Egelsbachrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Eringe= (Donau)rna>">/" e<' />>
/" e<' />>
/" e<' />>
Errhart Körtingrna>">/" e<' />>
Erud Barak"top">/" e<' />>
Erud Olmertrna>">/" e<' />>
">/" e<' />>
+xml" tEichstättngEichstättrna>">/" e<' />>
Eidge=össisbre Technisbre Hochschule Zürichrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Eilenburgrna>">/" e<' />>
Einbruch"top">/" e<' />>
/" e<' />>
">/" e<' />>
/" e<' />>
Einkaufstipprna>">/" e<' />>
/" e<' />>
EinsFestivalrna>">/" e<' />>
/" e<' />>
Einstweilige Anordnungrna>">/" e<' />>
Einstweilige Verfügungrna>">/" e<' />>
Eintracht Braunsbrweig"top">/" e<' />>
Eintracht Frankfurtrna>">/" e<' />>
">/" e<' />>
Einzellerrna>">/" e<' />>
Eisbärrna>">/" e<' />>
Eisbäre= Berli=rna>">/" e<' />>
Eisenachrna>">/" e<' />>
Eisenbahn-Baurna>">/" e<' />>
+xml" tEisenbahn-Butsesamt">Eisenbahn-Butsesamtrna>">/" e<' />>
+xml" tEisenbahnunternehme= Madagaskar">Eisenbahnunternehme= Madagaskar"top">/" e<' />>
+xml" tEisenstadt">Eisenstadtrna>">/" e<' />>
Eisenstadt (regional)rna>">/" e<' />>
Eishockey (Artikel)rna>">/" e<' />>
Eishockey in Deutsbrlandrna>">/" e<' />>
Eishockey in Europarna>">/" e<' />>
+xml" tEishockey-Weltmeistersbraft">Eishockey-Weltmeistersbraftrna>">/" e<' />>
/" e<' />>
/" e<' />>
/" e<' />>
Eissbrnelllaufrna>">/" e<' />>
EKDrna>">/" e<' />>
Ekin Deligözrna>">/" e<' />>
Ekkehard Sbrulzrna>">/" e<' />>
Ekkehard Voigtrna>">/" e<' />>
/" e<' />>
El Alrna>">/" e<' />>
El Aramrna>">/" e<' />>
El Arishrna>">/" e<' />>
El Kefrna>">/" e<' />>
El Paso"top">/" e<' />>
El Tarrarna>">/" e<' />>
Elazığrna>">/" e<' />>
Elbarna>">/" e<' />>
+xml" tElbe">Elberna>">/" e<' />>
Elchrna>">/" e<' />>
Electronic Frontier Foutsationrna>">/" e<' />>
+xml" tElefant">Elefantrna>">/" e<' />>
Elektrisbre Energierna>">/" e<' />>
Elektroautorna>">/" e<' />>
ElektroGrna>">/" e<' />>
+xml" tElektroindustrie">Elektroindustrierna>">/" e<' />>
+xml" tElektronikhersteller">Elektronikherstellerrna>">/" e<' />>
+xml" tElektronisbre Kriegführung">Elektronisbre Kriegführungrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Element of Crimerna>">/" e<' />>
Elena von Spanienrna>">/" e<' />>
Elfe=beinküste Politikrna>">/" e<' />>
">/" e<' />>
Elfriede Jelinekrna>">/" e<' />>
">/" e<' />>
r">Elisabeth Gee">rrna>">/" e<' />>
/" e<' />>
+xml" tElisabeth Volkman=">Elisabeth Volkman=rna>">/" e<' />>
Elistarna>">/" e<' />>
Elizabeth II. (Commonwealth)rna>">/" e<' />>
Elizabeth Taylorrna>">/" e<' />>
Elke Fernerrna>">/" e<' />>
Elke Hoffrna>">/" e<' />>
Elke Wülfing"top">/" e<' />>
Ellen Johnson-Sirleafrna>">/" e<' />>
Ellesmere Portrna>">/" e<' />>
">/" e<' />>
Ellweiler"top">/" e<' />>
Elmar Brokrna>">/" e<' />>
Elmshornrna>">/" e<' />>
">/" e<' />>
+xml" tElsterwerda">Elsterwerdarna>">/" e<' />>
/" e<' />>
Elvis Presleyrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Embargorna>">/" e<' />>
Embraerrna>">/" e<' />>
Embryonensbrutzgesetzrna>">/" e<' />>
/" e<' />>
s">Emirat>srna>">/" e<' />>
/" e<' />>
Emme=dinge=rna>">/" e<' />>
Empfängnisverhütungrna>">/" e<' />>
Emsdettenrna>">/" e<' />>
EnBWrna>">/" e<' />>
Enceladusrna>">/" e<' />>
Enda Kennyrna>">/" e<' />>
Endicott Davisonrna>">/" e<' />>
/" e<' />>
E=er1 Group Inc.rna>">/" e<' />>
E=ergieeinsparungrna>">/" e<' />>
E=ergieknappheitrna>">/" e<' />>
E=ergiepolitikrna>">/" e<' />>
E=ergiesteuergesetzrna>">/" e<' />>
E=ergietechnikrna>">/" e<' />>
+xml" tE=ergieträger">E=ergieträgerrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Englisbre Fußballnationalmannsbraftrna>">/" e<' />>
/" e<' />>
E=kenbach-Alsenbornrna>">/" e<' />>
E=nepetalrna>">/" e<' />>
E=rique Bolaños Geyerrna>">/" e<' />>
Enterprise (Alabama)rna>">/" e<' />>
Entführungrna>">/" e<' />>
E=tsendegesetzrna>">/" e<' />>
E=tsorgungsanlagenbrandrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
E=twicklungspolitikrna>">/" e<' />>
E=tziehung Minderjährigerrna>">/" e<' />>
Enzephalitisrna>">/" e<' />>
">/" e<' />>
Enzyklopädierna>">/" e<' />>
EPArna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Erbach (Odenwald)rna>">/" e<' />>
Erblindungrna>">/" e<' />>
/" e<' />>
Erdingrna>">/" e<' />>
Erdmondrna>">/" e<' />>
Erdölrna>">/" e<' />>
Erdölproduktionrna>">/" e<' />>
Erdorbitmissionrna>">/" e<' />>
Erdrutsbrrna>">/" e<' />>
Erftstadtrna>">/" e<' />>
Erfurtrna>">/" e<' />>
Erfurt (regional)rna>">/" e<' />>
Erfurter Industriebahnrna>">/" e<' />>
Erich Honeckerrna>">/" e<' />>
Erich Lindenberg"top">/" e<' />>
Ericssonrna>">/" e<' />>
Erik Hunkerrna>">/" e<' />>
Erika Steinbachrna>">/" e<' />>
Eriwanrna>">/" e<' />>
/" e<' />>
=">Ermittlungsverfae">=rna>">/" e<' />>
Ernährungrna>">/" e<' />>
Erneuerbare Energierna>">/" e<' />>
+xml" tErnst Cramer">Ernst Cramer"top">/" e<' />>
Ernst Messersbrmidrna>">/" e<' />>
Ernst Probstrna>">/" e<' />>
Ernst Rauerna>">/" e<' />>
Ernst Strasserrna>">/" e<' />>
Ernst Uhrlaurna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Erpressungrna>">/" e<' />>
Erster Weltkriegrna>">/" e<' />>
Ervin Skelarna>">/" e<' />>
Erwin Huberrna>">/" e<' />>
Erwin Kemnarna>">/" e<' />>
Erzgebirge Auerna>">/" e<' />>
Erziehungs">">/" e<' />>
ESArna>">/" e<' />>
Escaldes-Engordanyrna>">/" e<' />>
Eschbornrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Espace Mittellandrna>">/" e<' />>
Espanyol Barcelonarna>">/" e<' />>
Esperantorna>">/" e<' />>
">/" e<' />>
+xml" tEspinho">Espinhorna>">/" e<' />>
Espoorna>">/" e<' />>
/" e<' />>
Esse= Topojewrna>">/" e<' />>
Esse=bachrna>">/" e<' />>
Estrer Gdivlerrna>">/" e<' />>
">/" e<' />>
ETArna>">/" e<' />>
">/" e<' />>
+xml" tEtihad AirwaysngEtihad Airways"top">/" e<' />>
">/" e<' />>
+xml" tEttelbrück">Ettelbrückrna>">/" e<' />>
Etzelwangrna>">/" e<' />>
EU-Außenpolitikrna>">/" e<' />>
EU-Erweinerungrna>">/" e<' />>
EU-Lärmsbrutzrichtlinierna>">/" e<' />>
">/" e<' />>
EU-Richtlinierna>">/" e<' />>
EU-Verfassungrna>">/" e<' />>
EU-Zahlungsverkehrsgesetzrna>">/" e<' />>
EUFORrna>">/" e<' />>
EuGHrna>">/" e<' />>
EuHbGrna>">/" e<' />>
Eurorna>">/" e<' />>
Eurocopter"top">/" e<' />>
Europäisbre Bank für Wiederaufbau und E=twicklungrna>">/" e<' />>
+xml" tEuropäisbre Gesbrichte">Europäisbre Gesbrichte"top">/" e<' />>
Europäisbre Investitionsbankrna>">/" e<' />>
Europäisbre Kommissionrna>">/" e<' />>
+xml" tEuropäisbre Mensbrenrechtskonvention">Europäisbre Mensbrenrechtskonvention"top">/" e<' />>
">/" e<' />>
">/" e<' />>
Europäisbrer Metallarbeinerverband"top">/" e<' />>
Europäisbres Haftbefehlsgesetzrna>">/" e<' />>
/" e<' />>
+xml" tEuropäisbres Parlament">Europäisbres Parlamentrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
+xml" tEuropawahl 2009ytEuropawahl 2009rna>">/" e<' />>
">/" e<' />>
+xml" tEuropolytEuropolrna>">/" e<' />>
/" e<' />>
+xml" tEurostatytEurostatrna>">/" e<' />>
+xml" tEurovision Song ContestytEurovision Song Contestrna>">/" e<' />>
+xml" tEurowingsytEurowingsrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
/" e<' />>
+xml" tEuzebiusz Smolarek">Euzebiusz Smolarekrna>">/" e<' />>
Eva Airrna>">/" e<' />>
Eva Haulerna>">/" e<' />>
Eva Herzigovárna>">/" e<' />>
Eva Jolyrna>">/" e<' />>
">/" e<' />>
Evakuierungrna>">/" e<' />>
Evan Brownrna>">/" e<' />>
Evangelikalismusrna>">/" e<' />>
Evangelisbre Kirbrerna>">/" e<' />>
+xml" tEvangelisbre Kirbre in Deutsbrland">Evangelisbre Kirbre in Deutsbrlandrna>">/" e<' />>
Evangelisbre Studentengemeinderna>">/" e<' />>
+xml" tEvangelisbrer Kirbrentag">Evangelisbrer Kirbrentagrna>">/" e<' />>
+xml" tEvangelos Venizelos">Evangelos Venizelosrna>">/" e<' />>
">/" e<' />>
+xml" tEvelyn Haman=">Evelyn Haman=rna>">/" e<' />>
Evelyn Künnekerna>">/" e<' />>
">/" e<' />>
s">Evo Moral>srna>">/" e<' />>
Evonik Industriesrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
+xml" tExhumierung">Exhumierungrna>">/" e<' />>
+xml" tExobiologie">Exobiologierna>">/" e<' />>
+xml" tExoMars">ExoMarsrna>">/" e<' />>
+xml" tExplorer (Suborbitalflugzeug)">Explorer (Suborbitalflugzeug)rna>">/" e<' />>
+xml" tExplosion">Explosionrna>">/" e<' />>
Express AM3rna>">/" e<' />>
rrestrisbre Physik">Extrat>rrestrisbre Physikrna>">/" e<' />>
EZBrna>">/" e<' />>
EZLNrna>">/" e<' />>
F. K. Waechterrna>">/" e<' />>
FAArna>">/" e<' />>
Fabio Bianbrettirna>">/" e<' />>
">/" e<' />>
Fachhochsbrule Jenarna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Faenzarna>">/" e<' />>
Fahndungrna>">/" e<' />>
+xml" tFahre= ohne Führersbrei=">Fahre= ohne Führersbrei=rna>">/" e<' />>
+xml" tFahre= unter Drogenei=fluss">Fahre= unter Drogenei=flussrna>">/" e<' />>
Fahrerfluchtrna>">/" e<' />>
Fahrlässige Tötungrna>">/" e<' />>
Fahrradindustrierna>">/" e<' />>
Fährsbriffrna>">/" e<' />>
+xml" tFahrsbrule">Fahrsbrulerna>">/" e<' />>
Fahrverbotrna>">/" e<' />>
Fährverkehrrna>">/" e<' />>
Fahrzeugbrandrna>">/" e<' />>
Fahrzeugkontrollerna>">/" e<' />>
Fahrzeugtechnikrna>">/" e<' />>
Fairbanksrna>">/" e<' />>
Fairbrildrna>">/" e<' />>
Fairfax (Virginia)rna>">/" e<' />>
Fairfield (Connecticut)rna>">/" e<' />>
Falangerna>">/" e<' />>
/" e<' />>
Falco= (Flugzeug)rna>">/" e<' />>
Falco=Sat2rna>">/" e<' />>
/" e<' />>
Falsbre Verdächtigungrna>">/" e<' />>
Falsbrmeldungrna>">/" e<' />>
+xml" tFälsbrung technisbrer Aufzeichnunge=">Fälsbrung technisbrer Aufzeichnunge=rna>">/" e<' />>
Falun Gongrna>">/" e<' />>
Familien-Partei Deutsbrlandsrna>">/" e<' />>
Familienplanungrna>">/" e<' />>
Familienpolitikrna>">/" e<' />>
/" e<' />>
Fannie Maerna>">/" e<' />>
+xml" tFantasyfilm">Fantasyfilmrna>">/" e<' />>
Fanørna>">/" e<' />>
FAOrna>">/" e<' />>
FARCrna>">/" e<' />>
Farid Rifaatrna>">/" e<' />>
Farmingto= (Connecticut)rna>">/" e<' />>
Färöisbre Außenpolitik"top">/" e<' />>
/" e<' />>
FAUrna>">/" e<' />>
/" e<' />>
Faure Gndivingbérna>">/" e<' />>
Faye Dunawayrna>">/" e<' />>
Fayetteville (Georgia)rna>">/" e<' />>
Fayettvillerna>">/" e<' />>
FBIrna>">/" e<' />>
+xml" tFC Aarau">FC Aarau"top">/" e<' />>
+xml" tFC Augsburg">FC Augsburgrna>">/" e<' />>
+xml" tFC Barcelona">FC Barcelonarna>">/" e<' />>
">/" e<' />>
">/" e<' />>
FC Brüggerna>">/" e<' />>
FC Carl Zeiss Jenarna>">/" e<' />>
FC Energie Cottbusrna>">/" e<' />>
">/" e<' />>
FC Malagarna>">/" e<' />>
+xml" tFC Middlesbrough">FC Middlesbroughrna>">/" e<' />>
FC Portorna>">/" e<' />>
FC Red Bull Salzburgrna>">/" e<' />>
FC Rot-Weiß Erfurtrna>">/" e<' />>
+xml" tFC São Paulo">FC São Paulo"top">/" e<' />>
+xml" tFC SbraffhausenytFC Sbraffhausenrna>">/" e<' />>
">/" e<' />>
FC Sevillarna>">/" e<' />>
">/" e<' />>
">/" e<' />>
+xml" tFC ThunytFC Thunrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Fédération Aéronautique Internationalerna>">/" e<' />>
Federico Francorna>">/" e<' />>
Federico Lombardirna>">/" e<' />>
+xml" tFedEx">FedExrna>">/" e<' />>
">/" e<' />>
Fei Junlongrna>">/" e<' />>
Feiertagrna>">/" e<' />>
Feindlibre Übernahmerna>">/" e<' />>
Feinwerktechnikrna>">/" e<' />>
Feisabadrna>">/" e<' />>
Feldbergrna>">/" e<' />>
Feldkirbrrna>">/" e<' />>
Feldtagrna>">/" e<' />>
+xml" tFelibitas Hoppe">Felibitas Hopperna>">/" e<' />>
Felipe Calderónrna>">/" e<' />>
Felipe Mdivarna>">/" e<' />>
Felipe Perez Roquerna>">/" e<' />>
Felipe von Spanienrna>">/" e<' />>
Felix Burda Stiftungrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Felix Leinenrna>">/" e<' />>
Felix Magathrna>">/" e<' />>
Felix Neureutrerrna>">/" e<' />>
FeMrna>">/" e<' />>
">/" e<' />>
Ferdinand Dudenhöfferrna>">/" e<' />>
Ferdinand Piëbrrna>">/" e<' />>
Ferenc Gyurcsányrna>">/" e<' />>
Fernando Alonsorna>">/" e<' />>
Fernando Lugorna>">/" e<' />>
Fernsehdiskussionrna>">/" e<' />>
Fernsehmedienrna>">/" e<' />>
Fernsehsender allg.rna>">/" e<' />>
Fernsehsendungrna>">/" e<' />>
">/" e<' />>
Fernsehtechnikrna>">/" e<' />>
">/" e<' />>
Ferrerorna>">/" e<' />>
">/" e<' />>
Festnetzstörungrna>">/" e<' />>
Festus Mogaerna>">/" e<' />>
Feuerwehrrna>">/" e<' />>
+xml" tFeuerwehreinsatz">Feuerwehreinsatzrna>">/" e<' />>
Feyenoord Rotterdamrna>">/" e<' />>
FFIIrna>">/" e<' />>
Ff=rna>">/" e<' />>
FIArna>">/" e<' />>
">/" e<' />>
Fiatrna>">/" e<' />>
Fidel Castrorna>">/" e<' />>
Fideszrna>">/" e<' />>
/" e<' />>
Fieberrna>">/" e<' />>
Fields-Medaillerna>">/" e<' />>
FIFArna>">/" e<' />>
FIFA-Disziplinarkommissionrna>">/" e<' />>
Filderstadtrna>">/" e<' />>
File-Sharingrna>">/" e<' />>
Filippo Inzaghirna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Filmmusikrna>">/" e<' />>
+xml" tFilmnews">Filmnewsrna>">/" e<' />>
+xml" tFilmpreisngFilmpreisrna>">/" e<' />>
">/" e<' />>
Filmproduzentrna>">/" e<' />>
Filmtechnikrna>">/" e<' />>
">/" e<' />>
FINArna>">/" e<' />>
Financial Times Deutsbrlandrna>">/" e<' />>
Finanzkriserna>">/" e<' />>
Finanzmarktstabilisierungsgesetzrna>">/" e<' />>
Finanzpolitikrna>">/" e<' />>
">/" e<' />>
Finnairrna>">/" e<' />>
Finnlandrna>">/" e<' />>
Firmenbeteiligungrna>">/" e<' />>
Firmenhallenbrandrna>">/" e<' />>
Firmenkontaktmesserna>">/" e<' />>
Firmensoftwarerna>">/" e<' />>
Fisbrrna>">/" e<' />>
Fisbrereirna>">/" e<' />>
Fisbrfangrna>">/" e<' />>
Flavio Briatorerna>">/" e<' />>
Flemming Meyerrna>">/" e<' />>
Flensburgrna>">/" e<' />>
Fliegerbomberna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Florian Gersterrna>">/" e<' />>
Florian Kringerna>">/" e<' />>
Floridarna>">/" e<' />>
+xml" tFlörsheim am MainytFlörsheim am Mainrna>">/" e<' />>
">/" e<' />>
Flüchtlingrna>">/" e<' />>
Fluggesellsbraft allg.rna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Flugrafen Bagdadrna>">/" e<' />>
Flugrafen Bangkok (Don Muang)rna>">/" e<' />>
Flugrafen Bangkok (Suvarnabhumi)rna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Flugrafen Beilngriesrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
+xml" tFlugrafen Berlin-TempelhofngFlugrafen Berlin-Tempelhofrna>">/" e<' />>
+xml" tFlugrafen BiersetngFlugrafen Biersetrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
+xml" tFlugrafen ChetumalytFlugrafen Chetumalrna>">/" e<' />>
Flugrafen Chicago Midwayrna>">/" e<' />>
+xml" tFlugrafen Chicago O’Hare">Flugrafen Chicago O’Harerna>">/" e<' />>
+xml" tFlugrafen Chichén Itzá">Flugrafen Chichén Itzárna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Flugrafen Doncasterrna>">/" e<' />>
Flugrafen Dortmundrna>">/" e<' />>
+xml" tFlugrafen DresdenytFlugrafen Dresdenrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Flugrafen Erfurtrna>">/" e<' />>
Flugrafen Erfurt GmbHrna>">/" e<' />>
">/" e<' />>
+xml" tFlugrafen FriedrichsrafenytFlugrafen Friedrichsrafenrna>">/" e<' />>
">/" e<' />>
+xml" tFlugrafen Göteborg-Landvetter">Flugrafen Göteborg-Landvetterrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Flugrafen Hamburgrna>">/" e<' />>
Flugrafen Hamburg-Finkenwerderrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Flugrafen Johannesburgrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Flugrafen Kiel-Holtenaurna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Flugrafen Lahorerna>">/" e<' />>
Flugrafen Langkawirna>">/" e<' />>
">/" e<' />>
Flugrafen Leipzig/Hallerna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Flugrafen Madridrna>">/" e<' />>
+xml" tFlugrafen Maiquetia">Flugrafen Maiquetiarna>">/" e<' />>
+xml" tFlugrafen Marina di Campo">Flugrafen Marina di Camporna>">/" e<' />>
+xml" tFlugrafen MedellinytFlugrafen Medellinrna>">/" e<' />>
">/" e<' />>
Flugrafen Méridarna>">/" e<' />>
Flugrafen Mojaverna>">/" e<' />>
Flugrafen Münbren Franz Josef Straußrna>">/" e<' />>
+xml" tFlugrafen Nairobi">Flugrafen Nairobirna>">/" e<' />>
Flugrafen Naryan-Marrna>">/" e<' />>
">/" e<' />>
/" e<' />>
Flugrafen Nürnbergrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
+xml" tFlugrafen Pesbrawar">Flugrafen Pesbrawarrna>">/" e<' />>
Flugrafen Playa del Carmenrna>">/" e<' />>
">/" e<' />>
Flugrafen Pucallparna>">/" e<' />>
Flugrafen Pudongrna>">/" e<' />>
">/" e<' />>
Flugrafen Salzburgrna>">/" e<' />>
+xml" tFlugrafen SbrönhagenytFlugrafen Sbrönhagenrna>">/" e<' />>
+xml" tFlugrafen Singapur">Flugrafen Singapurrna>">/" e<' />>
Flugrafen Stuttgartrna>">/" e<' />>
Flugrafen Thessalonikirna>">/" e<' />>
+xml" tFlugrafen Tōkyō (Narita International Airport)ytFlugrafen Tōkyō (Narita International Airport)rna>">/" e<' />>
">/" e<' />>
+xml" tFlugrafen Turin (Caselle)ytFlugrafen Turin (Caselle)rna>">/" e<' />>
Flugrafen Ufarna>">/" e<' />>
Flugrafen Vágarrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Flugrafenbrandrna>">/" e<' />>
Flugrafenfeuerwehrrna>">/" e<' />>
+xml" tFlugrafengesellsbraft">Flugrafengesellsbraftrna>">/" e<' />>
Flugmodellsportrna>">/" e<' />>
+xml" tFlugplatz BanakytFlugplatz Banakrna>">/" e<' />>
Flugplatz Dingolfingrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Flugsibrerreitrna>">/" e<' />>
Flugsibrerungsunternehmenrna>">/" e<' />>
Flugsportrna>">/" e<' />>
Flugunfallrna>">/" e<' />>
Flugunternehmenrna>">/" e<' />>
Flugverkehrrna>">/" e<' />>
Flugzeugabsturzrna>">/" e<' />>
Flugzeugeigenbaurna>">/" e<' />>
Flugzeugherstellerrna>">/" e<' />>
Flugzeughersteller allg.rna>">/" e<' />>
Flugzwisbrenfallrna>">/" e<' />>
+xml" tFly Air">Fly Airrna>">/" e<' />>
+xml" tFlybe">Flyberna>">/" e<' />>
FNrna>">/" e<' />>
FNIrna>">/" e<' />>
+xml" tFobus-Grunt">Fobus-Gruntrna>">/" e<' />>
Föderationskreis Sibirienrna>">/" e<' />>
Fokkerrna>">/" e<' />>
Folklorismusrna>">/" e<' />>
Folterrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Formel 1 allg.rna>">/" e<' />>
Formelsportrna>">/" e<' />>
Forvarna>">/" e<' />>
Forvmarkrna>">/" e<' />>
Forvt (Lausitz)rna>">/" e<' />>
Forvtwirtsbraftrna>">/" e<' />>
Fort Lauderdalerna>">/" e<' />>
Fort Leavenworthrna>">/" e<' />>
Fort Meaderna>">/" e<' />>
Fort Sumnerrna>">/" e<' />>
Fort Worthrna>">/" e<' />>
Forza Italiarna>">/" e<' />>
Forza Nuovarna>">/" e<' />>
Foster and Partnersrna>">/" e<' />>
Fouad Mebazaârna>">/" e<' />>
Fox Broadcasting Companyrna>">/" e<' />>
Fox TVrna>">/" e<' />>
FPÖrna>">/" e<' />>
+xml" tFrachtverkehr">Frachtverkehrrna>">/" e<' />>
+xml" tFranche-Comté">Franche-Comtérna>">/" e<' />>
Francis Campbellrna>">/" e<' />>
Francisco Flores Pérezrna>">/" e<' />>
Francisco Francorna>">/" e<' />>
Franck Ribéryrna>">/" e<' />>
Franco Costanzorna>">/" e<' />>
Franco Frattinirna>">/" e<' />>
Franco Marinirna>">/" e<' />>
François Bayrourna>">/" e<' />>
François Bokorna>">/" e<' />>
François Bozizesrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
François Mitterrandrna>">/" e<' />>
Frank Appelrna>">/" e<' />>
+xml" tFrank Bsirske">Frank Bsirskerna>">/" e<' />>
+xml" tFrank Fae">nhorst">Frank Fae">nhorstrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Frank P">/" e<' />>
Frank Schirrmacrerrna>">/" e<' />>
Frank Schwerdtrna>">/" e<' />>
Frank Ulrich Montgomeryrna>">/" e<' />>
Frank-Jürgen Weiserna>">/" e<' />>
Frank-Walter Steinmeierrna>">/" e<' />>
">/" e<' />>
+xml" tFrankenberg/Sa.ngFrankenberg/Sa.rna>">/" e<' />>
+xml" tFrankenthalngFrankenthalrna>">/" e<' />>
Frankfortrna>">/" e<' />>
Frankfurt (Oder)rna>">/" e<' />>
">/" e<' />>
Frankfurter Allgemeine Zeitungrna>">/" e<' />>
Frankfurter Buchmesserna>">/" e<' />>
Frankfurter Rundsbraurna>">/" e<' />>
">/" e<' />>
Franky Geerna>">/" e<' />>
Franz Beckenbauerrna>">/" e<' />>
Franz Dänekamprna>">/" e<' />>
Franz Handlosrna>">/" e<' />>
Franz Josef Jungrna>">/" e<' />>
Franz Josef Straußrna>">/" e<' />>
Franz Münteferingrna>">/" e<' />>
Franz Sbrönhuberrna>">/" e<' />>
Franz Sbrwagerrna>">/" e<' />>
">/" e<' />>
Franz-Josef Bergrna>">/" e<' />>
Franz-Joseph-Landrna>">/" e<' />>
Französisbre Außenpolitikrna>">/" e<' />>
Französisbre Fußballnationalmannsbraftrna>">/" e<' />>
Französisbre Personalierna>">/" e<' />>
/" e<' />>
Fraportrna>">/" e<' />>
Frauenförderungrna>">/" e<' />>
+xml" tFrauenfußball">Frauenfußballrna>">/" e<' />>
Fraunhofer-Gesellsbraftrna>">/" e<' />>
Fred Delmarerna>">/" e<' />>
Fred Kalvirna>">/" e<' />>
Freddie Mercuryrna>">/" e<' />>
Frederikshavnrna>">/" e<' />>
">/" e<' />>
+xml" tFreetown">Freetownrna>">/" e<' />>
Frei Ottorna>">/" e<' />>
+xml" tFreiberg (Sachsen)ytFreiberg (Sachsen)rna>">/" e<' />>
+xml" tFreiburg (Kanton)ytFreiburg (Kanton)rna>">/" e<' />>
Freiburg im Breisgaurna>">/" e<' />>
Freiburg im Üechtlandrna>">/" e<' />>
+xml" tFreie Universität Berlin">Freie Universität Berlinrna>">/" e<' />>
+xml" tFreies Wisse=">Freies Wisse=rna>">/" e<' />>
Freireit statt Angstrna>">/" e<' />>
Freireitiberaubungrna>">/" e<' />>
Frei">/" e<' />>
Freivingrna>">/" e<' />>
+xml" tFreivtadt">Freivtadtrna>">/" e<' />>
Freiwillige Feuerwehrrna>">/" e<' />>
Freizeitgevtaltungrna>">/" e<' />>
Freizeitparkrna>">/" e<' />>
Freizeitunfallrna>">/" e<' />>
Frelimorna>">/" e<' />>
+xml" tFrère AloisngFrère Aloisrna>">/" e<' />>
Frère Rogerrna>">/" e<' />>
+xml" tFrese=ius AG">Frese=ius AGrna>">/" e<' />>
Fridolfingrna>">/" e<' />>
Friedbergrna>">/" e<' />>
">/" e<' />>
Friedensbewegungrna>">/" e<' />>
Friedensnobelpreivrna>">/" e<' />>
Friedenspreiv des deutsbren Buchhandelvrna>">/" e<' />>
Friederike de Haavrna>">/" e<' />>
Friedhelm Funkelrna>">/" e<' />>
Friedhofsrechtrna>">/" e<' />>
Friedlibre Demonstrationrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Friedrich Kurzrna>">/" e<' />>
Friedrich Merzrna>">/" e<' />>
Friedrich Wetterrna>">/" e<' />>
Friedrich-Alexander-Universität Erlangen-Nürnbergrna>">/" e<' />>
+xml" tFriedrich-Ebert-Stiftung">Friedrich-Ebert-Stiftungrna>">/" e<' />>
Friedrich-Loeffler-Institutrna>">/" e<' />>
Friedrich-Schiller-Universität Jenarna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Friedwald GmbHrna>">/" e<' />>
">/" e<' />>
Fristlose Kündigungrna>">/" e<' />>
/" e<' />>
/" e<' />>
Fritz Rothrna>">/" e<' />>
Fritzlarrna>">/" e<' />>
/" e<' />>
Fromentinerna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
FSV Zwickaurna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Fuldarna>">/" e<' />>
">/" e<' />>
Fulpmesrna>">/" e<' />>
">/" e<' />>
Fundrechtrna>">/" e<' />>
">/" e<' />>
Fürstenwalderna>">/" e<' />>
Fürthrna>">/" e<' />>
">/" e<' />>
Füsse=rna>">/" e<' />>
Futtermittelherstellerrna>">/" e<' />>
Future!rna>">/" e<' />>
Fuzhourna>">/" e<' />>
Fußball allg.rna>">/" e<' />>
">/" e<' />>
">/" e<' />>
+xml" tFußball in der SchweizytFußball in der Schweizrna>">/" e<' />>
+xml" tFußball in Deutsbrland">Fußball in Deutsbrlandrna>">/" e<' />>
Fußball in Englandrna>">/" e<' />>
+xml" tFußball in EuropaytFußball in Europarna>">/" e<' />>
">/" e<' />>
Fußball in Griebrenlandrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
+xml" tFußball in Liebrtenstei=">Fußball in Liebrtenstei=rna>">/" e<' />>
">/" e<' />>
+xml" tFußball in PolenytFußball in Polenrna>">/" e<' />>
+xml" tFußball in Russland">Fußball in Russlandrna>">/" e<' />>
+xml" tFußball in SerbienytFußball in Serbienrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Fußball-2.Bundesliga dt.rna>">/" e<' />>
">/" e<' />>
+xml" tFußball-Bundesliga dt. allg.">Fußball-Bundesliga dt. allg.rna>">/" e<' />>
+xml" tFußball-Europameivtersbraft 2008ytFußball-Europameivtersbraft 2008rna>">/" e<' />>
">/" e<' />>
+xml" tFußball-Europameivtersbraft 2016ytFußball-Europameivtersbraft 2016rna>">/" e<' />>
Fußball-Europameivtersbraft allg.rna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
+xml" tFußball-Weltmeivtersbraft 2014ytFußball-Weltmeivtersbraft 2014rna>">/" e<' />>
">/" e<' />>
">/" e<' />>
sytFußballer des Jae">srna>">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
">/" e<' />>
Fußballspieler allg.rna>">/" e<' />>
Fußballtrainerrna>">/" e<' />>
FY-2Drna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Gaboronerna>">/" e<' />>
Gabriele Paulirna>">/" e<' />>
Gabun Politikrna>">/" e<' />>
GAIArna>">/" e<' />>
Gainesville (Florida)rna>">/" e<' />>
GALrna>">/" e<' />>
Galapagosinselnrna>">/" e<' />>
Galaxie Airlinerna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Galileo (Satellinennavigation)rna>">/" e<' />>
Galileo Galileirna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Gamal Mubarakrna>">/" e<' />>
Gambisbre Personalierna>">/" e<' />>
Gambisbre Politikrna>">/" e<' />>
GameCuberna>">/" e<' />>
Ganderkeseerna>">/" e<' />>
Gandhinagarrna>">/" e<' />>
Gansurna>">/" e<' />>
Garbring b.Münbrenrna>">/" e<' />>
Gardanrna>">/" e<' />>
Gardezrna>">/" e<' />>
Garisvarna>">/" e<' />>
Garmisbr-Partenkirbrenrna>">/" e<' />>
Garri Kasparowrna>">/" e<' />>
Gary Altrna>">/" e<' />>
Gary Moorerna>">/" e<' />>
Gary Paffettrna>">/" e<' />>
Gaspromrna>">/" e<' />>
Gaststättenbrandrna>">/" e<' />>
Gaststättenrechtrna>">/" e<' />>
">/" e<' />>
">/" e<' />>
Gaza (Stadt)rna>">/" e<' />>
Gazastreifenrna>">/" e<' />>
Gazianteprna>">/" e<' />>
Gazimağuvarna>">/" e<' />>
GDBArna>">/" e<' />>
GD">GALrna>">/" e<' />>
GD">GALr88yt" tGau-Aiactu.com >+xml" tGDL">GD">GALr88yt" tGauJhref="http://de.wikiactu.com1945">+xml" tFuball-Bundesliga dt. allg.">Fußball-Bundev clre-inemebäudelre-inemebäudelre-ihref="http://de.wikiactu.com1188ym+xml" tFritG8rna>">/" e<' />>
Gardezrna>">/" e<' />>
<5"titlefeldnem-mebh"><5"titlefeldnehref="http://de.wikiactu.com5350y>+xml" tFuL">GALrna>">/" e<' />>
nsatz lre-eebüna>nsatz lrhref="http://de.wikiactu.com1747ym+xml" tFuiedlibre Demonstration">Friedlibre Demonst>>
">/" e<' />>
Frelimorna>">/" e<' />>
Gabriele Paulirna>">/" e<' /855 lre-inemeebuytstag">+xml" tGAW-21ytFSW-21rna>">/" e<' />>
Freiburg im ÜechtlF2eibe-inem-2eebuytstag">< clreebuytstag">< chref="http://de.wikiactu.com9668ym+xml" tG0ßball-Weltmeivtersbraft der Frauen 2011yG0ßbe-inem-2eebuytstag">< 1lreebuytstag">< href="http://de.wikiactu.com386y>+xml" tFu66misbr-Partenkirbren">Garmisbr-Partenkirbr66mise-inem-2eebuytstag">< 2lreebuytstag">< href="http://de.wikiactu.com724y>+xml" tFu97ziantep">Gazianteprna>">/" e<' />>
">/G6ßblre-inemeefährd lrytitlLuftle">Gazastreifenrna>">/" e<' />> ">">inem-415le">">inem-415le">">">/" e<' />>0e<' />> lre-eef"> lrhref="http://de.wikiactu.com4871ym+xml" tGanco Marini">Franco Marinirna>">/" e<' />>iv clre-inemefängnislreefängnishref="http://de.wikiactu.com5350y>+xml" t30rtwangenytFurtwangenrna>">/" e<' />> ">/" e<' />>
">/" e<' /meFußball-Bund54">/" e<' /meitle lre-eeitle lrref="http://de.wikiactu.com149ym+xml" tGarm8ball-Bundesliga dt. allg.">Fußball-Bundm8b/" e<' /mei>Freiburg im Üechtla8eibe-inem-2eei>+xml" t3ank JauchytFrank Jauchrna>">/" e<' />> /" e<' />>7ei>li>li>>7eldfäle"> lre-eeldfäle"> lrhref="http://de.wikiactu.com1214y>+xml" tGDelimo">Frelimorna>">/" e<' />>
Fußball in Englandrna3">/" e<' />>eeldv clre-ineeldv clre-href="http://de.wikiactu.com8170ym+xml" tG6ßball in Liebrtenstei=">Fußball in LiebG6ßb e<' />>eelde">ns>ns>Frank-Jürgen Weiserna>010b e<' />>eeldwä0ytiineeldwä0ytihref="http://de.wikiactu.com4243"m+xml" tG7leries Lafayette"tGaleries Lafayetterna>"G7ler e<' />>eeldwä0ytigesetzineeldwä0ytigesetzref="http://de.wikiactu.com724y>+xml" tFu95baller des Jae">sytFußballer des Jae">s95ba e<' />>eelitlve"form lre-eelitlve"form lrhref="http://de.wikiactu.com1188ym+xml" tFeW-22ytFSW-22rna>">/" e<' />>
>eelslre-inem lreelslre-inem href="http://de.wikiactu.com7430ym+xml" tFutstättenbrand">Gaststättenbrandrna>">/"43-2 e<' />>eelteninem-1eelteninemref="http://de.wikiactu.com724y>+xml" tFu95k PFrank P">/" e<' />>59ibe-inem-2ee98ytgefährd lr-1ee98ytgefährd lrref="http://de.wikiactu.com724y>+xml" tFu91iedrich II. (Preußen)ytFriedrich II. (Pr91iede-inem-2ee9onaytil Frinem-42e9onaytil Frinemhref="http://de.wikiactu.com1188ym+xml" tFek PFrank P">/" e<' />159ibe-inem-2eene"al Electric-42ene"al Electricref="http://de.wikiactu.com724y>+xml" tFu98iedrichsdorfngFriedrichsdorfrna>">/" e<' 98iede-inem-2eene"al Habibine-`Adem-42ene"al Habibine-`Ademhref="http://de.wikiactu.com2764ym+xml" tGarball in EuropaytFußball in Europarna>">arbe-inem-2eene"al Moto slreene"al Moto shref="http://de.wikiactu.com1188ym+xml" tFrL">GALrna>">/" e<' />>
e-inem-2eene"albnem-5ae">< inem lreeene"albnem-5ae">< inem lref="http://de.wikiactu.com566"m+xml" tGazaeiburg (Kanton)ytFreiburg (Kanton)rna>">/zaeibe-inem-2eene"altle">kreeene"altle">khref="http://de.wikiactu.com1188ym+xml" tFrlimo">Frelimorna>">/" e<' />>
kreeenere-href="http://de.wikiactu.com8170ym+xml" t1lapagosinseln">Galapagosinselnrna>">/" e<1/>>
"G clre-inem lem llemhref="http://de.wikiactu.com8170ym+xml" tG3ßball in England">Fußball in EnglandrnaG3ßbre-inem lGaspromrna>">/" e<' />>
Gazastreifenrna>">/" e<' />> e-inem-2eentechnik (botanem-3ineeentechnik (botanem-3ihref="http://de.wikiactu.com2473"m+xml" tG0misbr-Partenkirbren">Garmisbr-PartenkirbrG0mise-inem-2eentechnik (humanineeentechnik (humanihref="http://de.wikiactu.com6391y>+xml" tF2ßball-Weltmeivtersbraft 1974ytFußball-WF2ßbe-inem-2eentechnik (Nutztiereineeentechnik (Nutztiereihref="http://de.wikiactu.com2338y>+xml" tFuère Roger">Frère Rogerrna>">/" e<' />> <357be-inem-2eentesanemen eGaspromrna>">/" e<' />>
Frère Rogerrna>">/" e<' />> Garbring b.MünbrenrnaGDrbre-inem-2eeologlre-ieologlrhref="http://de.wikiactu.com4078y>+xml" tFrnz Sbrönhuber">Franz Sbrönhuberrna>">/"
kreeeophys>khref="http://de.wikiactu.com4243"m+xml" tGalileo Galilei">Galileo Galileirna>">/" eFrank-Jürgen WeisernaG8ankv clre-ineorg Hackm-8meorg Hackmref="http://de.wikiactu.com724y>+xml" tFu98axy 15"tGalaxy 15rna>">/" e<' />>
">/" e<' />>
Gambisbre PersonalierFumbiv clre-ineorg Schmidytneorg Schmidhref="http://de.wikiactu.com4243"m+xml" tGa7bisbre Politik">Gambisbre Politikrna>">/" 77iv clre-ineorg Winckmerytneorg Winckmerhref="http://de.wikiactu.com7727ym+xml" tGaßball in FrankreichytFußball in Frankrei79nkv clre-ineorg Witle"elytneorg Witle"elref="http://de.wikiactu.com386y>+xml" tFu64elimo">Frelimorna>">/" e<' />>
Fußballtrainerrna>">/" eFundrechtrna>">/" e<' />>
/" e<' /22drv clre-ineorge Clooneym l/" e<' /meorge Felosm l/" e<02b/" e<' /meorge Patakiytneorge Patakiref="http://de.wikiactu.com386y>+xml" tFu678ball-Bundesliga dt. allg.">Fußball-Bun678b/" e<' /meorge Sorosm l"95rb/" e<' /meorge Tupou V.m lFußball allg.rna>">/" e<' /l0bav clre-ineorgi Parwanem-34Friedr29bv clre-ineorgij Gongadse-34">/" e<' />>
Gambisbre Politikrna>">/Fr7biv clre-ineram lFreivtadtrna>">/" e<' />>
Frère Rogerrna>">/" e<' />> <447blre-inemeertle"Rale"keneeertle"Rale"keref="http://de.wikiactu.com386y>+xml" tFu6020ytG-20rna>">/" e<' />>
<5Lat<5LatFreie Universit30eielre-inemeér">Fußball in EnglandrnaG1ßblre-inemeerd Mü2731y(le">"Fuaerlre-inemeerd Niebaumneeerd Niebaumhref="http://de.wikiactu.com2668ym+xml" tG8eie Universität Berlin">Freie UniversitG8eielre-inemeerd Westdickergrna>"eerd Westdickergrnahref="http://de.wikiactu.com4871ym+xml" tGbriele Pauli">Gabriele Paulirna>">/" e<' 455 lre-inemeerda Hasselfeldt>"eerda Hasselfeldthref="http://de.wikiactu.com5350y>+xml" t3aD">GALr88yt" tGau-Aiactu.com >+xml" tGDL"3aD">lre-inemeerh"><5Ittnerytnerh"><5Ittnerhref="http://de.wikiactu.com6391y>+xml" tF2lapagosinseln">Galapagosinselnrna>">/" e<5Ludwig Mü2731ytnerh"><5Ludwig Mü2731ref="http://de.wikiactu.com566"m+xml" tGazaßball in der SchweizytFußball in der Sczaßblre-inemeerh"><5Maria Wagnerytnerh"><5Maria Wagnerhref="http://de.wikiactu.com4623"m+xml" tGa0ytG-20rna>">/" e<' />>
<5"tiröderytnerh"><5"tiröderhref="http://de.wikiactu.com8170ym+xml" tGarstreifen">Gazastreifenrna>">/" e<' />> <5"ti<5"ti">/" e<' />>
t Baumneeerh">t Baumref="http://de.wikiactu.com741"m+xml" tGal0ank-Jürgen Weise">Frank-Jürgen Weiserna7010b e<' />>eee">ussm lusshref="http://de.wikiactu.com2473"m+xml" tGball allg.">Fußball allg.rna>">/" e<' /2bav clre-inee">+xml" tGAballer des Jae">sytFußballer des Jae">s52ba e<' />>eerli>Fridolfingrna>">/" e<' />> >eermania Fluggesell-inem lnem-5eermania Fluggesell-inem lnemhref="http://de.wikiactu.com4871ym+xml" tGature!">Future!rna>">/" e<' />>
>eermanwi>+xml" tFu98anco Marini">Franco Marinirna>">/" e<' />98anc e<' />>eermar Rudolf-5eermar Rudolfref="http://de.wikiactu.com741"m+xml" tGalabxy 15"tGalaxy 15rna>">/" e<' />>
>eermGarbring b.Münbrenrna>"iede-inem-2eermFridolfingrna>">/" e<' />> Fußball allg.rna>">/" e<' /42bav clre-ineesfeld (Ritleineeersfeld (Ritleiref="http://de.wikiactu.com724y>+xml" tFu95ball in EuropaytFußball in Europarna>"95av clre-ineet5"tobelytneet5"tobelhref="http://de.wikiactu.com2473"m+xml" tGaeiburg im Üechtland">Freiburg im ÜechtlGaeibv clre-ineetrude Be"lekytneetrude Be"lekhref="http://de.wikiactu.com5206y>+xml" tGAaller des Jae">sytFußballer des Jae">s52bv clre-ine-inäfasbee">">/" e<' />>
digkeitsüblre-ireit lr-1ee-inwi>digkeitsüblre-ireit lrhref="http://de.wikiactu.com8170ym+xml" tG5ßball in England">Fußball in EnglandrnaG5ßblre-inemee-inwim lrem loinem-ale"> le Emsd> le Emsd>Gaza (Stadt)rna>">/" e<' />> <0anc e<' />>eesetz ge+xml" tFuball-Bundesliga dt. allg.">Fußball-Bundevnc e<' />>eesetz zur Neure"G095b e<' />>eesetzentwuem-1eesetzentwuemref="http://de.wikiactu.com386y>+xml" tFu64ry Paffett">Gary Paffettrna>">/" e<' />> 64ry e<' />>eesetzaeb lr-1ee-etzaeb lrref="http://de.wikiactu.com724y>+xml" tFu6chalngFunchalrna>">/" e<' />>
>eesetzaeb lrinem lreeesetzaeb lrinem lref="http://de.wikiactu.com386y>+xml" tFu64rchalngFunchalrna>">/" e<' />>
>eesetzaeb lri95ytitl lre-ä30ytin Uninem lGazimağuvarna>">/" e<' />> Gabun Politikrna>">/" e<' />> 9xy e<' />>eesundnem lree-undnem href="http://de.wikiactu.com1188ym+xml" tFr2ytG-20rna>">/" e<' />>
>eesundnem inem lreeesundnem inem lref="http://de.wikiactu.com386y>+xml" tFu64r2ytG-20rna>">/" e<' />>
>eesundnem i>
Gazimağuvarna>">/" e<' />> >eesundnem sv clre-ineesundnem sv clre-ref="http://de.wikiactu.com741"m+xml" tGalaiball in Liebrtenstei=">Fußball in Liebrtrre-inem-2eesundnem sv clre-
Gambisbre Politikrna>">/G0mbie-inem-2eesundnem sPolorm leesundnem sPolormhref="http://de.wikiactu.com2473"m+xml" tGleries Lafayette"tGaleries Lafayetterna>"2/" e<' />> Gazimağuvarna>">/" e<' />> > Garmisbr-Partenkirbrenrur e<' />>eetaf7 leetaf7href="http://de.wikiactu.com1188ym+xml" tFe0dolfing">Fridolfingrna>">/" e<' />> >eetaf7 FC leetaf7 FChref="http://de.wikiactu.com4871ym+xml" tG07ball allg.">Fußball allg.rna>">/" e<' /407ba e<' />>eevelsgrna>"eevelsgrnahref="http://de.wikiactu.com1188ym+xml" tFeststättenrecht">Gaststättenrechtrna>">/"5e<' />> "eEWref="http://de.wikiactu.com741"m+xml" tGal0ère Roger">Frère Rogerrna>">/" e<' />> l0èr e<' />>eewahrsam leewahrsamhref="http://de.wikiactu.com8170ym+xml" tG5drecht">Fundrechtrna>">/" e<' />>
< 9ytiigeiv monstra-inem l<">< 9ytiigeiv monstra-ineref="http://de.wikiactu.com724y>+xml" tFu97bisbre Politik">Gambisbre Politikrna>">/977iv clre-ine">< 9ytiigeiEskala-inem l<">< 9ytiigeiEskala-inehref="http://de.wikiactu.com7506y>+xml" tGattermittelhersteller">FuttermittelherstelGattev clre-ine"erbemesse-34<"erbemesseref="http://de.wikiactu.com386y>+xml" tFu69sprom">Gaspromrna>">/" e<' />>
Gardezrna>">/" e<' />>
Freiburg im Üechtll0eibv clre-ine"erk-inem lNahr lr-lGaza (Stadt)rna>">/" e<' />> 90anc e<' />>ee"erk-inem lSüdam>ee"erk-inem lUSAinne"erk-inem lUSAhref="http://de.wikiactu.com5206y>+xml" tGAßball in PolenytFußball in Polenrna>">/"2ßblre-inemeew">"F6aerlre-inemeew5879rlrne""879rhref="http://de.wikiactu.com1214y>+xml" tGDzhou">Fuzhourna>">/" e<' />>
"eEZref="http://de.wikiactu.com386y>+xml" tFu65ßball in ItalienytFußball in Italienrna65ßbe-inem-8Ghazniytnhaznihref="http://de.wikiactu.com2473"m+xml" tG95ball in EuropaytFußball in Europarna>"G995b e<' />>eiancarlo Fisem-4ll-inniancarlo Fisem-4ll-ref="http://de.wikiactu.com724y>+xml" tFu95xy 15"tGalaxy 15rna>">/" e<' />>
">/" e<' /Gie">+xml" tG040ytG-20rna>">/" e<' />>
Gaststättenbrandrna>">/"363 e<' />>eiitlet Felem-42iitlet Felemhref="http://de.wikiactu.com2473"m+xml" tG2hatiytGauhatirna>">/" e<' />>
>eiitleto da Silva Melo-42iitleto da Silva Melohref="http://de.wikiactu.com1214y>+xml" tG8nz Sbrönhuber">Franz Sbrönhuberrna>">/G8nz e<' />>eiitleto eii-42iitleto 2iiref="http://de.wikiactu.com741"m+xml" tGal8iedrichsdorfngFriedrichsdorfrna>">/" e<' 78iede-inem-2eiitleto Pagani-42iitleto Paganihref="http://de.wikiactu.com8170ym+xml" tG25drecht">Fundrechtrna>">/" e<' />>
Ganderkeseerna>">/" e<' />> Gambisbre Personalierna9bv clre-iniorgi Papua-inwiem-42iorgi Papua-inwiemhref="http://de.wikiactu.com8170ym+xml" tG2aeries Lafayette"tGaleries Lafayetterna>"8v clre-inem liorgio Armani-42iorgio Armaniref="http://de.wikiactu.com149ym+xml" tGarmeiburg (Kanton)ytFreiburg (Kanton)rna>">/rmeibre-inem liorgio Nav clrano-42iorgio Nav clranohref="http://de.wikiactu.com3655"m+xml" tGaßball-Weltmeivtersbraft der Frauen 2011yt602b/" e<' /miorgio Rocca-42iorgio Roccahref="http://de.wikiactu.com5930ym+xml" tGA2">GALrna>">/" e<' />>
e-inem-2eiorgos Papnemreou-42iorgos Papnemreouhref="http://de.wikiactu.com1747ym+xml" tFu4imağuva">Gazimağuvarna>">/" e<' />> ">/" e<' />> Fußball in EnglandrnaG6ßblre-inemeiovanni Trapnttoni-42iovanni Trapnttoniref="http://de.wikiactu.com724y>+xml" tFu93D">GALr88yt" tGau-Aiactu.com >+xml" tGDL"93D">lre-inemeiove-A-42iove-Ahref="http://de.wikiactu.com4243"m+xml" tGalle"tGallerna>">/" e<' />>
lre-inemeiove-B-42iove-Bhref="http://de.wikiactu.com8170ym+xml" tG5lapagosinseln">Galapagosinselnrna>">/" e<'5laplre-inemeirija Prasad Koiral-innirija Prasad Koiral-href="http://de.wikiactu.com1945">+xml" tFuttermittelhersteller">FuttermittelherstelFuttelre-inemeisela Piltzineisela Piltzref="http://de.wikiactu.com386y>+xml" tFu64zhou">Fuzhourna>">/" e<' />>
Gazastreifenrna>">/" e<' />> <9a7stre-inem linemano Amato-42inemano Amatohref="http://de.wikiactu.com8170ym+xml" tG2aapagosinseln">Galapagosinselnrna>">/" e<'2laplre-inemeinemo Tr mon"titlinemo Tr mon"tref="http://de.wikiactu.com741"m+xml" tGal8iball-2.Bundesliga dt. (Spielbericht)ytFul
">/" e<' />>
Fuzhourna>">/" e<' />>
Fußball-Bund095b e<' />>eikiytitlVernunm lreikiytitlVernunm href="http://de.wikiactu.com4243"m+xml" tGa0un Politik">Gabun Politikrna>">/" e<' />> 01b e<' />>eikigem-34ikigemhref="http://de.wikiactu.com1747ym+xml" tFußball-1.Liga SlowakeiytFußball-1.Liga SFußb e<' />>eikigem R">Gazimağuvarna>">/" e<' />> >einem gele">>>GDBArna>">/" e<' />>
>einelre-irmflieGazimağuvarna>">/" e<' />> >einnda0ytiArizon lre-innda0ytiArizon lhref="http://de.wikiactu.com4243"m+xml" tGar2ytG-20rna>">/" e<' />>
Fußball allg.rna>">/" e<' /967bae-inem-2einnrothesre-innrotheshref="http://de.wikiactu.com8170ym+xml" t53mal Mubarak">Gamal Mubarakrna>">/" e<' />53male-inem-2eiobai-42iobaihref="http://de.wikiactu.com4243"m+xml" tGarball allg.">Fußball allg.rna>">/" e<' /42re-i588ytitliobai">">/" e<' />>
Gazimağuvarna>">/" e<' />> Frank-Jürgen Weiserna65ankv clre-inlückclre-inenlückclre-ihref="http://de.wikiactu.com4243"m+xml" tGaßball-Weltmeivtersbraft 1998ytFußball-W4elm Prinz vo6mnem- m lmnem- href="http://de.wikiactu.com1945">+xml" tFueries Lafayette"tGaleries Lafayetterna>"F9lm Prinz vo6nadm lre-inemnadm lre-iref="http://de.wikiactu.com724y>+xml" tFu86ßball in PolenytFußball in Polenrna>">/G623>lre-inemeniacingbé Eyadémanemnaacingbé Eyadémaref="http://de.wikiactu.com724y>+xml" tFu6zimağuva">Gazimağuvarna>">/" e<' />> > <5"pace Flight Cen ee-42odd"><5"pace Flight Cen eeref="http://de.wikiactu.com149ym+xml" tGarmiedrich II. (Preußen)ytFriedrich II. (Prrmied<' />> +xml" tFu987nco Marini">Franco Marinirna>">/" e<' />9875d<' />> +xml" tFu6ßball-1.Liga SlowakeiytFußball-1.Liga S6ßb<' />> Fridolfingrna>">/" e<' />> > Future!rna>">/" e<' />>
> ">/" e<' />> > Gary Moorerna>">/" e<' />>
> Gazimağuvarna>">/" e<' />> Gazimağuvarna>">/" e<' />> +xml" tFu5x4mağuva">Gazimağuvarna>">/" e<' />> +xml" tFu65nchalngFunchalrna>">/" e<' />>
Gabriele Paulirna>">/" e<' 41vnc e<' />>eonzalo Castronenoezalo Castrohref="http://de.wikiactu.com2473"m+xml" tGaiedrich II. (Preußen)ytFriedrich II. (Pr2mied<' />> sytFußballer des Jae">s15ba e<' />>eoogitle"oogithref="http://de.wikiactu.com7506y>+xml" tGarre Roger">Frère Rogerrna>">/" e<' />> Garrlre-inemeöppi>>eorch Fock (F9l8lre-orch Fock (F9l8lhref="http://de.wikiactu.com1214y>+xml" tG8lball in ItalienytFußball in ItalienrnaG8lb e<' />>eordon Br1ytitnordon Br1ythref="http://de.wikiactu.com3655"m+xml" tGaßball in PolenytFußball in Polenrna>">/3623>lre-inemeordon Coopee-42ordon Coopeeref="http://de.wikiactu.com724y>+xml" tFu901a (Stadt)">Gaza (Stadt)rna>">/" e<' />> 901nc e<' />>eorizont 2baeorizont 2ref="http://de.wikiactu.com724y>+xml" tFu900ball-2.Bundesliga dt. (Spielbericht)ytF900b e<' />>eorkowski Awtomobilny Sawodnenorkowski Awtomobilny Sawodhref="http://de.wikiactu.com4871ym+xml" tGaßballtrainer">Fußballtrainerrna>">/" eGazianteprna>">/" e<' />>
Gaststättenbrandrna>">/30sts e<' />>eosec-ineosec-href="http://de.wikiactu.com5350y>+xml" t3ambisbre Personalie">Gambisbre Personalier3ambie-inem-2eötebona>"eötebonahref="http://de.wikiactu.com5350y>+xml" t30ttermittelhersteller">Futtermittelherstel30tte e<' />>eothanemotharef="http://de.wikiactu.com741"m+xml" tGalalball in ItalienytFußball in Italienrnalalb e<' />>eothic-42othichref="http://de.wikiactu.com4871ym+xml" tGaidolfing">Fridolfingrna>">/" e<' />> "G 7stre-inem lötz neorg7m lötz neorg7href="http://de.wikiactu.com1747ym+xml" tFu4ball-1.Liga SlowakeiytFußball-1.Liga SFuBA" e<' />>eoYellow Gnem-5eoYellow Gnemref="http://de.wikiactu.com724y>+xml" tFu96ank-Jürgen Weise">Frank-Jürgen Weiserna96ank e<' />>erab-inänd lr-1erab-inänd lrhref="http://de.wikiactu.com3655"m+xml" tGaßballfunktionärytFußballfunktionärrnaGaßb e<' />>erace Kelly-1erace Kellyhref="http://de.wikiactu.com3655"m+xml" tG7ßballfunktionärytFußballfunktionärrnaG7ßb e<' />>eracia Baur-1eracia Baurhref="http://de.wikiactu.com1188ym+xml" tFrz2ytG-20rna>">/" e<' />>
GALr88yt" tGau-Aiactu.com >+xml" tGDL"84D"> e<' />>eraf">+xml" tFu60mbisbre Politik">Gambisbre Politikrna>">/60mbie-inem-2erafie-inerafie-href="http://de.wikiactu.com4871ym+xml" tG9derkesee">Ganderkeseerna>">/" e<' />> +xml" tFu0ball-2.Bundesliga dt. (Spielbericht)ytF23zhov clre-inrammy-1erammyhref="http://de.wikiactu.com3655"m+xml" tG47ball allg.">Fußball allg.rna>">/" e<' /G47bav clre-inradiCanaria-1eradiCanariahref="http://de.wikiactu.com3655"m+xml" tG7ziantep">Gazianteprna>">/" e<' />>
">/" e<' />>
Garbring b.Münbrenrnal6rbre-inem-2eradi5Turk-1eradi5Turkhref="http://de.wikiactu.com1945">+xml" tFuteries Lafayette"tGaleries Lafayetterna>"Futere-inem-2eradse-ineradse-ref="http://de.wikiactu.com741"m+xml" tGalaiprom">Gaspromrna>">/" e<' />>
>eraphlker-1eraphlkerref="http://de.wikiactu.com724y>+xml" tFu88lileo Galilei">Galileo Galileirna>">/" e<88lil e<' />>erasbrunem lrasbrunehref="http://de.wikiactu.com1214y>+xml" tG08atiytGauhatirna>">/" e<' />>
>erasshoppee-Club Zürem lrnrasshoppee-Club Zürem href="http://de.wikiactu.com3655"m+xml" tGAxy 15"tGalaxy 15rna>">/" e<' />>
Fußball-Bund38b/" e<' /mrazm lrazhref="http://de.wikiactu.com1747ym+xml" tF0teries Lafayette"tGaleries Lafayetterna>"F0tere-inem-2eraz (regional)m lraz (regional)href="http://de.wikiactu.com7506y>+xml" tGabisbre Personalie">Gambisbre PersonalierGabie-inem-2ereergrlt (Maryland)m lreergrlt (Maryland)ref="http://de.wikiactu.com724y>+xml" tFu8ßballtrainer">Fußballtrainerrna>">/" e<83bie-inem-2ereerpeacem lreerpeaceref="http://de.wikiactu.com741"m+xml" tGalaun Politik">Gabun Politikrna>">/" e<' />laune-inem-2erefrat lrnrefrat href="http://de.wikiactu.com7727ym+xml" tGazball in FrankreichytFußball in Frankrei7idoe-inem-2ereg Possm lreg Posshref="http://de.wikiactu.com2473"m+xml" tG20ytG-20rna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />G1malv clre-inregory Olslrm lregory Olslrhref="http://de.wikiactu.com1188ym+xml" t5urball in EuropaytFußball in Europarna>"5arbe-inem-2ereifswald4ytreifswaldhref="http://de.wikiactu.com3655"m+xml" tGAtstättenbrand">Gaststättenbrandrna>">/398alv clre-inrennem lrerennem href="http://de.wikiactu.com5350y>+xml" t3a1eries Lafayette"tGaleries Lafayetterna>"3a1erv clre-inrenoblem lrenobleref="http://de.wikiactu.com724y>+xml" tFu81iedrichsdorfngFriedrichsdorfrna>">/" e<' 81iedv clre-inrettstadt>"erettstadthref="http://de.wikiactu.com4871ym+xml" tGar2ytG-20rna>">/" e<' />>
Freiburg im Üechtla0eibv clre-inrevle (Westfalen)lrerevle (Westfalen)ref="http://de.wikiactu.com724y>+xml" tFu9aeries Lafayette"tGaleries Lafayetterna>"9aerv clre-inrevlebroem lrnrevlebroem href="http://de.wikiactu.com2473"m+xml" tG7mbisbre Personalie">Gambisbre PersonalierG7mbiv clre-inrv cl30yti Fußballna-inealman -inem lrerv cl30yti Fußballna-inealman -inem ref="http://de.wikiactu.com741"m+xml" tGalaball in Liebrtenstei=">Fußball in Liebrthat e<' />>erv cl30ytis Militärw>ervgori Perelman797rvgori Perelmanhref="http://de.wikiactu.com4871ym+xml" tGaßballtrainer">Fußballtrainerrna>">/" e<4aßbv clre-inrimme Onl"le5Awa-ineerimme Onl"le5Awa-iref="http://de.wikiactu.com741"m+xml" tGal30un Politik">Gabun Politikrna>">/" e<' />l30unv clre-inrizzly Adams Wolfsbuna>"erizzly Adams Wolfsbunahref="http://de.wikiactu.com7506y>+xml" tGa0un Politik">Gabun Politikrna>">/" e<' />l50unv clre-inroitz0ytinnroitz0ythref="http://de.wikiactu.com3655"m+xml" tG72ball-Europameivtersbraft 2008ytFußball3u2bv clre-inrosny-1erosnyref="http://de.wikiactu.com386y>+xml" tFu6chalngFunchalrna>">/" e<' />>
">/" e<' />>
Fußball-Bun7evnc e<' />>eroßbeeren-1eroßbeerenhref="http://de.wikiactu.com1188ym+xml" t50al Mubarak">Gamal Mubarakrna>">/" e<' />5003c e<' />>eroßbrnem leroßbrnemref="http://de.wikiactu.com724y>+xml" tFu892ball in England">Fußball in EnglandrnaG92b e<' />>eroßenhain leroßenhainref="http://de.wikiactu.com741"m+xml" tGal3lball in ItalienytFußball in Italienrnal38b e<' />>eroßer Plre-ytitlUSA">Franco Marinirna>">/" e<' />Ga7nc e<' />>eroßes nom-41es Erinnzeinem lfü1yVerdi">Fußball allg.rna>">/" e<' /29b e<' />>eroßkatzelrnroßkatzehref="http://de.wikiactu.com3655"m+xml" tG7zball allg.">Fußball allg.rna>">/" e<' /G77bav clre-inrubenunglücklrnrubenunglückref="http://de.wikiactu.com724y>+xml" tFu84imağuva">Gazimağuvarna>">/" e<' />> +xml" tFu84ball in Liebrtenstei=">Fußball in LiebG3rrlre-inemerumman Aerospace Corpora-inem lrumman Aerospace Corpora-ineref="http://de.wikiactu.com724y>+xml" tFu88un Politik">Gabun Politikrna>">/" e<' />88une-inem-2eründauineründauhref="http://de.wikiactu.com4243"m+xml" tGttermittelhersteller">Futtermittelherstel4tte e<' />>erundgesetzinerundgesetzhref="http://de.wikiactu.com4871ym+xml" tGa7bisbre Politik">Gambisbre Politikrna>">/"577e e<' />>erundlre-i auf Gewährlre-t lrytir Veetraunem-keit und Integritä i> lorma-inestechni0ytir Systemenenrundlre-i auf Gewährlre-t lrytir Veetraunem-keit und Iref="http://de.wikiactu.com741"m+xml" tGal2chalngFunchalrna>">/" e<' />>
>erundlre-i auf > lorma-ineelle Selbstbestimm lr-1erundlre-i auf > lorma-ineelle Selbstbestimm lrhref="http://de.wikiactu.com4871ym+xml" tG9r2ytG-20rna>">/" e<' />>
> ">/" e<' />>
Fußball-Bun73vnc e<' />>e-ineidytn-ineidref="http://de.wikiactu.com386y>+xml" tFu62bxy 15"tGalaxy 15rna>">/" e<' />>
>eSLVytnSLVhref="http://de.wikiactu.com2473"m+xml" tG21a (Stadt)">Gaza (Stadt)rna>">/" e<' />> G21a e<' />>euangdenenuangderef="http://de.wikiactu.com386y>+xml" tFu67ry Paffett">Gary Paffettrna>">/" e<' />> 67ry e<' />>euangzhou-42uangzhouhref="http://de.wikiactu.com2473"m+xml" tG1xy 15"tGalaxy 15rna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />Gumale-inem-2euarambarénemuarambaréhref="http://de.wikiactu.com3655"m+xml" tG2aeries Lafayette"tGaleries Lafayetterna>"3v clre-inem lual" ala-Stadt>"eual" ala-Stadthref="http://de.wikiactu.com2473"m+xml" tGßballfunktionärytFußballfunktionärrna2937iv clre-inuglielmo5Marconi-42uglielmo5Marconihref="http://de.wikiactu.com2473"m+xml" tG0ßball in Liebrtenstei=">Fußball in LiebG0ßbv clre-inuido Westerwelle-42uido Westerwellehref="http://de.wikiactu.com8170ym+xml" tG2lileo Galilei">Galileo Galileirna>">/" e<8alilv clre-inuildfe-ineeuildfe-iref="http://de.wikiactu.com724y>+xml" tFu90eball-2.Bundesliga dt. (Spielbericht)ytF90lilv clre-inuillaumeyti Posm lrnuillaumeyti Posm ref="http://de.wikiactu.com741"m+xml" tGal30ball-2.Bundesliga dt. (Spielbericht)ytFu3zhov clre-inuillaumeySorolrnuillaumeySorohref="http://de.wikiactu.com7506y>+xml" tGarball in ItalienytFußball in Italienrnal5ßbe-inem-8Guinea-Bissau le">Fußball allg.rna>">/" e<' /869bae-inem-8Gulf Air-1eulf Airref="http://de.wikiactu.com724y>+xml" tFu887nco Marini">Franco Marinirna>">/" e<' />8875d<' />> Gardezrna>">/" e<' />>
> Gardezrna>">/" e<' />>
> Fuzhourna>">/" e<' />>
Garmisbr-PartenkirbrFu9isv clre-inüntir nrasslrnüntir nrasshref="http://de.wikiactu.com1214y>+xml" tG8iball-2.Bundesliga dt. (Spielbericht)ytF1l
+xml" tFuaxy 15"tGalaxy 15rna>">/" e<' />>
">/" e<' />>
Gamal Mubarakrna>">/" e<' />ßblre-inemeünttir Jauchm lünttir Jauchhref="http://de.wikiactu.com1188ym+xml" tFr9ball allg.">Fußball allg.rna>">/" e<' /Fr9balre-inemeünttir Oetti>+xml" tFu96ßball-1.Liga SlowakeiytFußball-1.Liga S96ßblre-inemeünttir Pla879rlrnünttir Pla879rref="http://de.wikiactu.com386y>+xml" tFu67rball-Bundesliga dt. allg.">Fußball-Bun67rbe-inem-2eünzbuna>"eünzbunaref="http://de.wikiactu.com386y>+xml" tFu65bxy 15"tGalaxy 15rna>">/" e<' />>
Frère Rogerrna>">/" e<' />> 38èrv clre-inurteelle m lurteelle ref="http://de.wikiactu.com386y>+xml" tFu69ßball in KroatienytFußball in Kroatienr69ßbv clre-inustav Humtletm lustav Humtletref="http://de.wikiactu.com724y>+xml" tFu5xteries Lafayette"tGaleries Lafayetterna>"5a7stre-inem lustav Klimtm lustav Klimthref="http://de.wikiactu.com2338y>+xml" tF63al Mubarak">Gamal Mubarakrna>">/" e<' />G63alre-inem lustavo Notoa-42ustavo Notoahref="http://de.wikiactu.com5350y>+xml" t380dolfing">Fridolfingrna>">/" e<' />> > > Fußball allg.rna>">/" e<' /4254b<' />> Gaza (Stadt)rna>">/" e<' />> Fe1a v clre-inü79rslohm lü79rslohref="http://de.wikiactu.com741"m+xml" tGa849al Mubarak">Gamal Mubarakrna>">/" e<' />849al<' />> "euttergrnahref="http://de.wikiactu.com1214y>+xml" tG39isbr-Partenkirbren">Garmisbr-Partenkirbreu9isv clre-inuy Veehofstadt>"euy Veehofstadthref="http://de.wikiactu.com4871ym+xml" tGa7balltrainer">Fußballtrainerrna>">/" e<4attw<' />> +xml" t38tball-Europameivtersbraft 2008ytFußball3875d<' />> Gabun Politikrna>">/" e<' />78une-inem-2H-II">H-IIref="http://de.wikiactu.com724y>+xml" tFu900ytG-20rna>">/" e<' />>
">/" e<' />>
Gamal Mubarakrna>">/" e<' />4male-inem-2Hacker-1Hackerref="http://de.wikiactu.com741"m+xml" tGal6zball in FrankreichytFußball in Frankrei66be-inem-2Hafa m Hafm ref="http://de.wikiactu.com741"m+xml" tGa85eie Universität Berlin">Freie Universit85eiee-inem-2Hafa Hambuna>"Hafa Hambunahref="http://de.wikiactu.com1188ym+xml" tFrzball allg.">Fußball allg.rna>">/" e<' /Frry e<' />>Haftbefehi-4Haftbefehihref="http://de.wikiactu.com2473"m+xml" tG1eries Lafayette"tGaleries Lafayetterna>"21erv clre-iHagåtña-4Hagåtñaref="http://de.wikiactu.com741"m+xml" tGal6rbisbre Personalie">Gambisbre PersonalierG6ttw<' />> GALrna>">/" e<' />>
e-inem-2Hag-n-4Hag- href="http://de.wikiactu.com1214y>+xml" tG7ttermittelhersteller">FuttermittelherstelF78">e-inem-2Hag-nthal-le-Bas-4Hag- thal-le-Bashref="http://de.wikiactu.com3655"m+xml" tG1chalngFunchalrna>">/" e<' />>
Fußballtrainerrna>">/" eGarbring b.Münbrenrna9arbre-inem-2Hainan-4Hainanhref="http://de.wikiactu.com1214y>+xml" tGrdez">Gardezrna>">/" e<' />>
> > Frère Rogerrna>">/" e<' />> 39iee-inem-2Hakan Samuelsson-4Hakan Samuelssonref="http://de.wikiactu.com386y>+xml" tFu65bbring b.Münbren">Garbring b.Münbrenrna65bbre-inem-2Hakkari-4Hakkarihref="http://de.wikiactu.com7506y>+xml" tG8mbisbre Personalie">Gambisbre PersonalierG8mbie-inem-2Hakki Keskin-4Hakki Keskinhref="http://de.wikiactu.com5350y>+xml" t38zimağuva">Gazimağuvarna>">/" e<' />> "Haitlestadthref="http://de.wikiactu.com2473"m+xml" tG24imağuva">Gazimağuvarna>">/" e<' />> Gamal Mubarakrna>">/" e<' />G8male-inem-2Halle fussball-Gal-inHalle fussball-Gal-ref="http://de.wikiactu.com724y>+xml" tFu97ßball in Liebrtenstei=">Fußball in Lieb97ßbe-inem-2Hallstatt>"Hailstattref="http://de.wikiactu.com724y>+xml" tFu58bisbre Personalie">Gambisbre Personalier58bie-inem-2Hallwang>"Hailwanghref="http://de.wikiactu.com4871ym+xml" tG62ball-Europameivtersbraft 2008ytFußballG62be-inem-2Hal79rn am See-4Hal79rn am Seeref="http://de.wikiactu.com724y>+xml" tFu8ßeries Lafayette"tGaleries Lafayetterna>"8ßere-inem-2Halv"><5Hanevold4yHalv"><5Hanevoldref="http://de.wikiactu.com741"m+xml" tGal6tstättenbrand">Gaststättenbrandrna>">/l6tse-inem-2Hamamatsu4yHamamatsuhref="http://de.wikiactu.com2473"m+xml" tG1ries Lafayette"tGaleries Lafayetterna>"21se-inem-2Hamas4yHamashref="http://de.wikiactu.com8170ym+xml" t5rbisbre Personalie">Gambisbre Personalier5ttw<' />> "Hambunahref="http://de.wikiactu.com1188ym+xml" t254imağuva">Gazimağuvarna>">/" e<' />> > "Hambunair "Vhref="http://de.wikiactu.com8170ym+xml" t52ßball in KroatienytFußball in Kroatienr52ßb<' />> Frère Rogerrna>">/" e<' />> l65be-inem-2Hamed De"> maa Farid Al Saidi-4Hamed De"> maa Farid Al Saidiref="http://de.wikiactu.com724y>+xml" tFu972dez">Gardezrna>">/" e<' />>
Gary Moorerna>">/" e<' />> ">/" e<' />>
Garbring b.Münbrenrna30bbre-inem-2Hamilton-4Hamiltonhref="http://de.wikiactu.com1214y>+xml" tG71a (Stadt)">Gaza (Stadt)rna>">/" e<' />> F715re-inem-2Hamilton (Ontario)-4Hamilton (Ontario)href="http://de.wikiactu.com7506y>+xml" tG18ball-Bundesliga dt. allg.">Fußball-BunG18be-inem-2Hamm-4Ham-href="http://de.wikiactu.com1188ym+xml" t67ßball-Weltmeivtersbraft der Frauen 2011y67ßbe-inem-2Hammelbuna>"Hammelbunahref="http://de.wikiactu.com2473"m+xml" tG8atiytGauhatirna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />Gu5ale-inem-2Handbnem-8Handbnemhref="http://de.wikiactu.com3655"m+xml" tG1rbring b.Münbren">Garbring b.Münbrenrna3140y/" e<' /Handbnem-EM">+xml" tGa7bisbre Politik">Gambisbre Politikrna>">/7577e e<' />>Handbnem-WM">+xml" tFu62rbisbre Personalie">Gambisbre Personalier62rbi e<' />>Handel mit Blutdiamant-n-4Handel mit Blutdiamant-nhref="http://de.wikiactu.com7506y>+xml" tGa7ball-2.Bundesliga dt. (Spielbericht)ytFutur<' />> Gaza (Stadt)rna>">/" e<' />> G17be-inem-2Hangzhou-4Hangzhouhref="http://de.wikiactu.com2473"m+xml" tG92dez">Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />G733re-inem-2Hannelore Kreuse-3Hannelore Kreusehref="http://de.wikiactu.com8170ym+xml" tG2leries Lafayette"tGaleries Lafayetterna>"G2lere-inem-2Hannelore Schmid -4Hannelore Schmid href="http://de.wikiactu.com4871ym+xml" tGmball-Europameivtersbraft 2008ytFußballG7be-inem-2Hannover-1Hannoverhref="http://de.wikiactu.com1188ym+xml" tFertwangenytFurtwangenrna>">/" e<' />> Fußball allg.rna>">/" e<' /4654be-inem-2Hannover Messe-3Hannover Messehref="http://de.wikiactu.com1214y>+xml" tG8rball-Bundesliga dt. allg.">Fußball-BunG8rbe-inem-2Hanns-Martin Schleyer-1Hanns-Martin Schleyerhref="http://de.wikiactu.com5350y>+xml" t35zball in FrankreichytFußball in Frankre35zbe-inem-2Hanoi-4Hanoiref="http://de.wikiactu.com724y>+xml" tFu98iedrich II. (Preußen)ytFriedrich II. (Pr98iede-inem-2Hanover (Maryland)m Hanover (Maryland)href="http://de.wikiactu.com1945">+xml" tFuun Politik">Gabun Politikrna>">/" e<' />Fuune-inem-2Hans Beetram-4Hans Beetramhref="http://de.wikiactu.com3655"m+xml" tG1rball allg.">Fußball allg.rna>">/" e<' /G144ne-inem-2Hans Chr30tian Aem-rs- m Hans Chr30tian Aem-rs- href="http://de.wikiactu.com2473"m+xml" tG8ßballländerspielytFußballländerspielrG8ßbe-inem-2Hans Eem-4lm Hans Eem-4lref="http://de.wikiactu.com724y>+xml" tFu96rball allg.">Fußball allg.rna>">/" e<' /96rbae-inem-2Hans Küegm Hans Küeghref="http://de.wikiactu.com7506y>+xml" tGa8atiytGauhatirna>">/" e<' />>
Fußball in Englandrna532be-inem-2Hans Podiuk-1Hans Podiukhref="http://de.wikiactu.com1188ym+xml" tFez2ytG-20rna>">/" e<' />>
Gazimağuvarna>">/" e<' />> Galapagosinselnrna>">/" e<'21me-inem-2Hans Sinleg4lm Hans Sinleg4lhref="http://de.wikiactu.com1214y>+xml" tG3mbisbre Personalie">Gambisbre PersonalierG3mbie-inem-2Hans Zehetmairm Hans Zehetmairref="http://de.wikiactu.com724y>+xml" tFu80un Politik">Gabun Politikrna>">/" e<' />830unv clre-iHans-Artur Bauckhage-3Hans-Artur Bauckhageref="http://de.wikiactu.com386y>+xml" tFu642apagosinseln">Galapagosinselnrna>">/" e<642apv clre-iHans-Böckler-Stiftuegm Hans-Böckler-Stiftueghref="http://de.wikiactu.com1188ym+xml" tFr4imağuva">Gazimağuvarna>">/" e<' />> Gamal Mubarakrna>">/" e<' />G9male-inem-2Hans-Dietir Flick-1Hans-Dietir Flickhref="http://de.wikiactu.com1188ym+xml" t251eries Lafayette"tGaleries Lafayetterna>"251erv clre-iHans-Dietr3e- Gen0ytir-1Hans-Dietr3e- Gen0ytirhref="http://de.wikiactu.com1214y>+xml" tG7ßballtrainer">Fußballtrainerrna>">/" e">/" e<' />>
">/" e<' />>
Gary Moorerna>">/" e<' />> "641erv clre-iHans-Petir Friedrem lrHans-Petir Friedrem ref="http://de.wikiactu.com724y>+xml" tFu90ytG-20rna>">/" e<' />>
<5Kom lrHans-Reinh"><5Kom href="http://de.wikiactu.com8170ym+xml" tG29isbr-Partenkirbren">Garmisbr-PartenkirbrG29isv clre-iHans-Rotlet Metilman m Hans-Rotlet Metilman href="http://de.wikiactu.com1188ym+xml" t254a (Stadt)">Gaza (Stadt)rna>">/" e<' />> G5ßbv clre-iHansa Rostock-1Hansa Rostockhref="http://de.wikiactu.com2473"m+xml" t43ball allg.">Fußball allg.rna>">/" e<' /4354be-inem-2Hanseat30ytis OtlelandesFußball allg.rna>">/" e<' /6354be-inem-2Hanspetir Latour-1Hanspetir Latourhref="http://de.wikiactu.com7506y>+xml" tGaun Politik">Gabun Politikrna>">/" e<' />75une-inem-2Hape Kerkeliegm Hape Kerkelieghref="http://de.wikiactu.com1214y>+xml" tG8idez">Gardezrna>">/" e<' />>
Gardezrna>">/" e<' />>
Freie Universit80eiee-inem-2Harald Pi>Freiburg im Üechtl84eibe-inem-2Harald SinertauinHarald Sinertauref="http://de.wikiactu.com741"m+xml" tGa80ßballländerspielytFußballländerspielr80ßbe-inem-2Harald Sinmid -4Harald Sinmid ref="http://de.wikiactu.com741"m+xml" tGa86teries Lafayette"tGaleries Lafayetterna>"86tere-inem-2Harald V. (NorweFrank-Jürgen Weiserna911be-inem-2HarardheereneHarardheerehref="http://de.wikiactu.com4871ym+xml" tG63ball allg.">Fußball allg.rna>">/" e<' /4634be-inem-2HarareneHararehref="http://de.wikiactu.com5350y>+xml" t350bisbre Personalie">Gambisbre Personalier3a0bv clre-iHard4yHa-iref="http://de.wikiactu.com724y>+xml" tFu94imağuva">Gazimağuvarna>">/" e<' />> Freiburg im ÜechtlG8eibv clre-iHardwarehlesteller allg.neHardwarehlesteller allg.ref="http://de.wikiactu.com724y>+xml" tFu97ßball-1.Liga SlowakeiytFußball-1.Liga S9ußb e<' />>HariboneHariboref="http://de.wikiactu.com741"m+xml" tGal0ball-Bundesliga dt. allg.">Fußball-Bun705bv clre-iHarli>">/" e<' />>
terneHarold Pi>terref="http://de.wikiactu.com724y>+xml" tFu906chalngFunchalrna>">/" e<' />>
>Harri ReinemneHarri Reinemhref="http://de.wikiactu.com3655"m+xml" tG1ère Roger">Frère Rogerrna>">/" e<' />> 315be-inem-2Harry BelafontmneHarry Belafontmref="http://de.wikiactu.com724y>+xml" tFu942ball-Europameivtersbraft 2008ytFußball942be-inem-2Harry OlympioneHarry Olympiohref="http://de.wikiactu.com8170ym+xml" t56xy 15"tGalaxy 15rna>">/" e<' />>
>Hartnem-79Hartnem-ref="http://de.wikiactu.com741"m+xml" tGa883ball allg.">Fußball allg.rna>">/" e<' /883ba e<' />>Hartlepool79Hartlepoolhref="http://de.wikiactu.com1214y>+xml" tG3mball-1.Liga SlowakeiytFußball-1.Liga SF32b e<' />>Hartmut Mehdor m Hartmut Mehdor href="http://de.wikiactu.com8170ym+xml" t56bisbre Personalie">Gambisbre Personalier5688b e<' />>Hartmut Möllriegm Hartmut Möllriegref="http://de.wikiactu.com386y>+xml" tFu69chalngFunchalrna>">/" e<' />>
>Hartz IVm Hartz IVhref="http://de.wikiactu.com2473"m+xml" t43rbring b.Münbren">Garbring b.Münbrenrna43rbr e<' />>Harv"><5Univlesitym Harv"><5Univlesityref="http://de.wikiactu.com724y>+xml" tFu68ball-2.Bundesliga dt. (Spielbericht)ytF68b e<' />>Hascl30ytm Hascl30ytref="http://de.wikiactu.com386y>+xml" tFu644ball in Liebrtenstei=">Fußball in Lieb644b e<' />>Hashim Thaçi-1Hashim Thaçihref="http://de.wikiactu.com8170ym+xml" t5riball-2.Bundesliga dt. (Spielbericht)ytF5rib e<' />>Hasik-1Hasa ref="http://de.wikiactu.com741"m+xml" tGa12rdez">Gardezrna>">/" e<' />>
Gazimağuvarna>">/" e<' />> Fußball allg.rna>">/" e<' /F5ry e<' />>Hassan Wirajudam Hassan Wirajudaref="http://de.wikiactu.com724y>+xml" tFu9aère Roger">Frère Rogerrna>">/" e<' />> 9aèr e<' />>Hat Yai-4Hat Yaihref="http://de.wikiactu.com5350y>+xml" t307bisbre Politik">Gambisbre Politikrna>">/307bi e<' />>Hatt-n-4Hatt-nhref="http://de.wikiactu.com7506y>+xml" t62ßballtrainer">Fußballtrainerrna>">/" e<62ßb e<' />>Hatti>Gaststättenbrandrna>">/60ts e<' />>Hauplre-ule Müesi>">/" e<' />>
Fußballtrainerrna>">/" eGardezrna>">/" e<' />>
Garmisbr-PartenkirbrF89isv clre-iHausfriedensgruytm Hausfriedensgruythref="http://de.wikiactu.com1188ym+xml" tFe4tstättenbrand">Gaststättenbrandrna>">/Fe4tsv clre-iHause-inem-8Hause-inemhref="http://de.wikiactu.com5350y>+xml" t33ststättenbrand">Gaststättenbrandrna>">/33sts e<' />>Hau eekrankuegm Hau eekrankueghref="http://de.wikiactu.com5350y>+xml" t38ßball-1.Liga SlowakeiytFußball-1.Liga S38ßb e<' />>Havannam Havannaref="http://de.wikiactu.com724y>+xml" tFu50bbring b.Münbren">Garbring b.Münbrenrna50bbre-inem-2Hawaii-4Hawaiiref="http://de.wikiactu.com741"m+xml" tGal60un Politik">Gabun Politikrna>">/" e<' />l60unv clre-iHaßlom lrHaßlom ref="http://de.wikiactu.com724y>+xml" tFu952apagosinseln">Galapagosinselnrna>">/" e<952apv clre-iHBOlrHBOref="http://de.wikiactu.com724y>+xml" tFu59mal Mubarak">Gamal Mubarakrna>">/" e<' />59male-inem-2HD+lrHD+href="http://de.wikiactu.com4871ym+xml" t60bisbre Politik">Gambisbre Politikrna>">/60bi e<' />>HD-DVD Promo-ine GrouplrHD-DVD Promo-ine Grouphref="http://de.wikiactu.com4871ym+xml" tG6teries Lafayette"tGaleries Lafayetterna>"G6tere-inem-2Heart of Midlothian F.C.neHeart of Midlothian F.C.ref="http://de.wikiactu.com741"m+xml" tGal33ball-Bundesliga dt. allg.">Fußball-Bun7335re-inem-2Heat-1XneHeat-1Xhref="http://de.wikiactu.com8170ym+xml" tGu9al Mubarak">Gamal Mubarakrna>">/" e<' />879ts e<' />>Heattir MillsneHeattir Millshref="http://de.wikiactu.com4871ym+xml" tG4rbring b.Münbren">Garbring b.Münbrenrna44rbr e<' />>Hre-i4lm Hre-i4lhref="http://de.wikiactu.com8170ym+xml" t53bisbre Politik">Gambisbre Politikrna>">/537iv clre-iHeerenvea m Heerenvea ref="http://de.wikiactu.com741"m+xml" tGa844tstättenbrand">Gaststättenbrandrna>">/844tsv clre-iHehlerei-4Hehlereihref="http://de.wikiactu.com2473"m+xml" tG91ball allg.">Fußball allg.rna>">/" e<' /21y e<' />>Heidelgrna>"Heidelgrnahref="http://de.wikiactu.com8170ym+xml" t53xy 15"tGalaxy 15rna>">/" e<' />>
>Heidemarie Wieczorek-Zeul>"Heidemarie Wieczorek-Zeulref="http://de.wikiactu.com386y>+xml" tFu65aeries Lafayette"tGaleries Lafayetterna>"65aer e<' />>Heidennem- an tir Binnz>"Heidennem- an tir Binnzhref="http://de.wikiactu.com4871ym+xml" tG0ßball-Weltmeivtersbraft der Frauen 2011yG0ßb e<' />>Heidi Klum>"Heidi Klumhref="http://de.wikiactu.com8170ym+xml" t52derkesee">Ganderkeseerna>">/" e<' />> >Heike Fi0ytir-1Heike Fi0ytirhref="http://de.wikiactu.com7506y>+xml" tGaidez">Gardezrna>">/" e<' />>
>Heike Trammir-1Heike Trammirhref="http://de.wikiactu.com2473"m+xml" tG41a (Stadt)">Gaza (Stadt)rna>">/" e<' />> G415re-inem-2Heiko5Maas4yHeiko5Maashref="http://de.wikiactu.com1214y>+xml" tG7a (Stadt)">Gaza (Stadt)rna>">/" e<' />> F735re-inem-2Heiko5Oltman s4yHeiko5Oltman shref="http://de.wikiactu.com2473"m+xml" tG06iburg im Üechtland">Freiburg im ÜechtlG06ibe-inem-2Heilbron m Heilbron href="http://de.wikiactu.com2473"m+xml" t48aeries Lafayette"tGaleries Lafayetterna>"48aere-inem-2Heilig">"Heilig">+xml" tFu91rtwangenytFurtwangenrna>">/" e<' />> "Heilig">Fußball-BunG0rbe-inem-2Heillecourt>"Heillecourthref="http://de.wikiactu.com7506y>+xml" t62tstättenbrand">Gaststättenbrandrna>">/6233re-inem-2Heinir Geißlir-1Heinir Geißlirhref="http://de.wikiactu.com8170ym+xml" t55chalngFunchalrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />48ale-inem-2Heinr3e- Bauir Verlaa>"Heinr3e- Bauir Verlaaref="http://de.wikiactu.com724y>+xml" tFu59ßball-1.Liga SlowakeiytFußball-1.Liga S59ßbe-inem-2Heinr3e- BoereneHeinr3e- Boereref="http://de.wikiactu.com724y>+xml" tFu59rball in EuropaytFußball in Europarna>"59rbe-inem-2Heinr3e- Harrir-1Heinr3e- Harrirhref="http://de.wikiactu.com7506y>+xml" tGazball allg.">Fußball allg.rna>">/" e<' /75ry e<' />>Heinr3e- Man m Heinr3e- Man href="http://de.wikiactu.com8170ym+xml" t56tstättenbrand">Gaststättenbrandrna>">/563ale-inem-2Heinr3e- vo "278ere-inem-2Heinz Fi0ytir-1Heinz Fi0ytirref="http://de.wikiactu.com741"m+xml" tGa882ileo Galilei">Galileo Galileirna>">/" e<8829re-inem-2Heinz Fromm-1Heinz Frommhref="http://de.wikiactu.com2473"m+xml" t48termittelhersteller">Futtermittelherstel4t40re-inem-2Heinz Josef Duestewitz-1Heinz Josef Duestewitzhref="http://de.wikiactu.com2473"m+xml" tG64tstättenbrand">Gaststättenbrandrna>">/G64tse-inem-2Heinz Kluncker-1Heinz Klunckerhref="http://de.wikiactu.com2473"m+xml" tG4xy 15"tGalaxy 15rna>">/" e<' />>
Gambisbre Politikrna>">/G77bie-inem-2Heinz-Harald Finntze m Heinz-Harald Finntze ref="http://de.wikiactu.com724y>+xml" tFu96xball-2.Bundesliga dt. (Spielbericht)ytFA619re-inem-2Heist>"Heistref="http://de.wikiactu.com724y>+xml" tFu78mal Mubarak">Gamal Mubarakrna>">/" e<' />78male-inem-2Heizo Takenaka>"Heizo Takenakaref="http://de.wikiactu.com724y>+xml" tFu98lball in ItalienytFußball in Italienrna98lbe-inem-2Heiße Kartoff4lm Hriße Kartoff4lhref="http://de.wikiactu.com7506y>+xml" t685al Mubarak">Gamal Mubarakrna>">/" e<' />685ale-inem-2Heißluftbnemone-inem-8Heißluftbnemone-inemhref="http://de.wikiactu.com5350y>+xml" t33xy 15"tGalaxy 15rna>">/" e<' />>
Galapagosinselnrna>">/" e<642ye-inem-2Helen Clark-1Helen Clarkhref="http://de.wikiactu.com1214y>+xml" tG8rball-1.Liga SlowakeiytFußball-1.Liga SF8zbe-inem-2Helen Vita-1Helen Vitaref="http://de.wikiactu.com386y>+xml" tFu66bisbre Politik">Gambisbre Politikrna>">/66bie-inem-2Helge Schneider-1Helge Schneiderhref="http://de.wikiactu.com8170ym+xml" t56teries Lafayette"tGaleries Lafayetterna>"56tere-inem-2Helgolnem lHelgolnemhref="http://de.wikiactu.com5350y>+xml" t39ßball in KroatienytFußball in Kroatienr39ßbe-inem-2Helios Airways4yHelios Airwaysref="http://de.wikiactu.com741"m+xml" tGal6un Politik">Gabun Politikrna>">/" e<' />769xye-inem-2Hellmut Krua>"Hellmut Kruaref="http://de.wikiactu.com741"m+xml" tGal0termittelhersteller">Futtermittelherstell0tee-inem-2Hells AngelsneHells Angelsref="http://de.wikiactu.com741"m+xml" tGal6ttermittelhersteller">Futtermittelherstell6ttee-inem-2Helmut Holter-1Helmut Holterhref="http://de.wikiactu.com8170ym+xml" tGu1imağuva">Gazimağuvarna>">/" e<' />> "Helmut Kletthref="http://de.wikiactu.com2473"m+xml" tG2ère Roger">Frère Rogerrna>">/" e<' />> G2ère-inem-2Helmut KohllrHelmut Kohlhref="http://de.wikiactu.com8170ym+xml" t550ytG-20rna>">/" e<' />>
Fußball allg.rna>">/" e<' /G7bae-inem-2Helsinki-1Helsinkihref="http://de.wikiactu.com4871ym+xml" tG420ytG-20rna>">/" e<' />>
Futtermittelherstell090ye-inem-2Hemet lHeme href="http://de.wikiactu.com2473"m+xml" tG5Are Roger">Frère Rogerrna>">/" e<' />> G5Are-inem-2Hemmi>Fußball-Bun66rbe-inem-2Henan-4Henanhref="http://de.wikiactu.com1214y>+xml" t76xball-2.Bundesliga dt. (Spielbericht)ytF7619re-inem-2Henkel KGaA-4Henkel KGaAhref="http://de.wikiactu.com1214y>+xml" tG8a (Stadt)">Gaza (Stadt)rna>">/" e<' />> F835re-inem-2Henni>< Sineem-1Henni>< Sineemhref="http://de.wikiactu.com3655"m+xml" tG1xy 15"tGalaxy 15rna>">/" e<' />>
">/" e<' />>
>Henr3 Mat30se-3Henr3 Mat30sehref="http://de.wikiactu.com1188ym+xml" tFr9isbr-Partenkirbren">Garmisbr-Partenkirbre199re-inem-2Henry K30si>+xml" t76mball-1.Liga SlowakeiytFußball-1.Liga S76mbe-inem-2Henry Maskem Henry Maskeref="http://de.wikiactu.com741"m+xml" tGa884imağuva">Gazimağuvarna>">/" e<' />> Gambisbre Personalier94biv clre-iHenry Paulson-4Henry Paulsonref="http://de.wikiactu.com724y>+xml" tFu64ball in Liebrtenstei=">Fußball in Lieb614b e<' />>Heppennem- (Bergstraße)-4Heppennem- (Bergstraße)href="http://de.wikiactu.com5350y>+xml" t396iburg im Üechtland">Freiburg im Üechtl396ib e<' />>Herat lHerathref="http://de.wikiactu.com3655"m+xml" t14rball-Bundesliga dt. allg.">Fußball-BunG4rbe-inem-2Hertlet Dreilim lrHertlet Dreilim ref="http://de.wikiactu.com741"m+xml" tGal34imağuva">Gazimağuvarna>">/" e<' />> Freiburg im Üechtl76mibv clre-iHertlet Grönemeyarm Hertlet Grönemeyarref="http://de.wikiactu.com386y>+xml" tFu692chalngFunchalrna>">/" e<' />>
">/" e<' />>
Gabun Politikrna>">/" e<' />75z2ye-inem-2Hertlet Wehnarm Hertlet Wehnarref="http://de.wikiactu.com741"m+xml" tGa81iedrich II. (Preußen)ytFriedrich II. (Pr81iede-inem-2Hertor m Hertor ref="http://de.wikiactu.com386y>+xml" tFu69chalngFunchalrna>">/" e<' />>
Ganderkeseerna>">/" e<' />> Gamal Mubarakrna>">/" e<' />G75ale-inem-2HeriegsinemlrHeriegsinemhref="http://de.wikiactu.com8170ym+xml" t560dolfing">Fridolfingrna>">/" e<' />> Frère Rogerrna>">/" e<' />> G4ère-inem-2Herman LuxlrHerman Luxhref="http://de.wikiactu.com2473"m+xml" tG9eiburg im Üechtland">Freiburg im ÜechtlG982re-inem-2Herman Maiarm Herman Maiarhref="http://de.wikiactu.com7506y>+xml" t68rball-Weltmeivtersbraft der Frauen 2011y6872re-inem-2Herman Maurarm Herman Maurirhref="http://de.wikiactu.com2473"m+xml" t19bisbre Personalie">Gambisbre Personalier19bie-inem-2Herman Otto Solmsm Herman Otto Solmsref="http://de.wikiactu.com724y>+xml" tFu972ileo Galilei">Galileo Galileirna>">/" e<972ile-inem-2Herman Rappem Herman Rappehref="http://de.wikiactu.com5350y>+xml" t324tstättenbrand">Gaststättenbrandrna>">/324tse-inem-2Herman Sinearm Herman Sinearref="http://de.wikiactu.com724y>+xml" tFu96ßball in KroatienytFußball in Kroatienr96ßbe-inem-2Herman vo Gaza (Stadt)rna>">/" e<' />> G715re-inem-2Herman -Josef Lamtletim Herman -Josef Lamtletihref="http://de.wikiactu.com8170ym+xml" t548ball-Bundesliga dt. allg.">Fußball-Bun548be-inem-2Hermeskeii-4Hermeskeiiref="http://de.wikiactu.com741"m+xml" tGa83termittelhersteller">Futtermittelherstel83tee-inem-2Hermosillo-4Hermosillohref="http://de.wikiactu.com4871ym+xml" t60ball allg.">Fußball allg.rna>">/" e<' /60lbe-inem-2Heroin-4Heroinhref="http://de.wikiactu.com5350y>+xml" t261imağuva">Gazimağuvarna>">/" e<' />> +xml" t944ball in Liebrtenstei=">Fußball in Lieb944b e<' />>Her0ytiim lHer0ytiimhref="http://de.wikiactu.com7506y>+xml" tGa9ball-Bundesliga dt. allg.">Fußball-Bun7a9b e<' />>Her0heylrHer0heyref="http://de.wikiactu.com724y>+xml" tFu592ileo Galilei">Galileo Galileirna>">/" e<592il e<' />>Herta MüllerneHerta Müllerref="http://de.wikiactu.com741"m+xml" tGa83Are Roger">Frère Rogerrna>">/" e<' />> 839iee-inem-2Hertfe-ishireneHertfe-ishirehref="http://de.wikiactu.com5350y>+xml" t230dolfing">Fridolfingrna>">/" e<' />> Fußball allg.rna>">/" e<' /843be-inem-2Herxnem- bei LandauinHerxnem- bei Landauhref="http://de.wikiactu.com2473"m+xml" tG5xball-2.Bundesliga dt. (Spielbericht)ytFG5xbe-inem-2Herzinsuffizinnz>"Herzinsuffizinnzhref="http://de.wikiactu.com1214y>+xml" t76dez">Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />G93ale-inem-2Herzog-nauram lrHerzog-nauram ref="http://de.wikiactu.com724y>+xml" tFu981xy 15"tGalaxy 15rna>">/" e<' />>
Gazimağuvarna>">/" e<' />> Gambisbre PersonalierG5bie-inem-2HETE-baHETE-href="http://de.wikiactu.com8170ym+xml" t562ball-Europameivtersbraft 2008ytFußball562be-inem-2Het-4lm Het-4lhref="http://de.wikiactu.com4871ym+xml" t637bisbre Politik">Gambisbre Politikrna>">/637bie-inem-2Hewa Bora-1Hewa Borahref="http://de.wikiactu.com1214y>+xml" t76aeries Lafayette"tGaleries Lafayetterna>"76aere-inem-2Hewlett-Packard4yHewlett-Packardref="http://de.wikiactu.com741"m+xml" tGa88rxy 15"tGalaxy 15rna>">/" e<' />>
Galileo Galileirna>">/" e<850ile-inem-2Hiddensee-4Hiddenseehref="http://de.wikiactu.com4871ym+xml" t60all allg.">Fußball allg.rna>">/" e<' /60lle-inem-2High Defini-ine Television-4High Defini-ine Televisionhref="http://de.wikiactu.com1214y>+xml" t76aimağuva">Gazimağuvarna>">/" e<' />> Freiburg im Üechtl73rbr e<' />>Hii maa-1Hii maahref="http://de.wikiactu.com5350y>+xml" t3zball allg.">Fußball allg.rna>">/" e<' /3ry e<' />>Hilary Swank-1Hilary Swankref="http://de.wikiactu.com741"m+xml" tGa884ball-Europameivtersbraft 2008ytFußball88ßbv clre-iHildbunahausan-4Hildbunahausanhref="http://de.wikiactu.com2473"m+xml" tG91a (Stadt)">Gaza (Stadt)rna>">/" e<' />> G91bv clre-iHilde Domin-4Hilde Dominref="http://de.wikiactu.com741"m+xml" tGal64un Politik">Gabun Politikrna>">/" e<' />7641bv clre-iHilde Grna>"Hilde Grnahref="http://de.wikiactu.com1214y>+xml" t76aball allg.">Fußball allg.rna>">/" e<' /7634be-inem-2Hildeg"><5Knef>"Hildeg"><5Knefhref="http://de.wikiactu.com2473"m+xml" t16iedrich II. (Preußen)ytFriedrich II. (Pr16iede-inem-2Hildesnem-79Hildesnem-ref="http://de.wikiactu.com386y>+xml" tFu69dolfing">Fridolfingrna>">/" e<' />> Fußball-BunG26bv clre-iHillary Clinton-4Hillary Clintonhref="http://de.wikiactu.com1214y>+xml" t797bisbre Politik">Gambisbre Politikrna>">/797bie-inem-2Hilmar Kopper-1Hilmar Kopperref="http://de.wikiactu.com741"m+xml" tGal64eries Lafayette"tGaleries Lafayetterna>"76rdee-inem-2Hilst>"Hilstref="http://de.wikiactu.com724y>+xml" tFu780ytG-20rna>">/" e<' />>
"Himawari 5href="http://de.wikiactu.com1214y>+xml" tG7al Mubarak">Gamal Mubarakrna>">/" e<' />G7ale-inem-2HinduismusneHinduismusref="http://de.wikiactu.com724y>+xml" tFu924chalngFunchalrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />9233re-inem-2Hi>terzart-n-4Hi>terzart-nref="http://de.wikiactu.com724y>+xml" tFu78ball-1.Liga SlowakeiytFußball-1.Liga S7890ye-inem-2Hirakawa-4Hirakawaref="http://de.wikiactu.com741"m+xml" tGal60n Politik">Gabun Politikrna>">/" e<' />l60ye-inem-2Hirnblutuegm Hirnblutueghref="http://de.wikiactu.com2473"m+xml" tG5Aeries Lafayette"tGaleries Lafayetterna>"25dee-inem-2Hirn0ytwelluegm Hirn0ytwelluegref="http://de.wikiactu.com741"m+xml" tGa83Aimağuva">Gazimağuvarna>">/" e<' />> Galileo Galileirna>">/" e<5sbe-inem-2Hisbollatm Hisbollathref="http://de.wikiactu.com5350y>+xml" t26tstättenbrand">Gaststättenbrandrna>">/G63re-inem-2Hissène Habrém Hissène Habréhref="http://de.wikiactu.com7506y>+xml" tGaball allg.">Fußball allg.rna>">/" e<' /75lb<' />> +xml" tFu78ball-1.Liga SlowakeiytFußball-1.Liga S789b<' />> +xml" tFu78bisbre Personalie">Gambisbre PersonalierG88b<' />> +xml" tG8rbisbre Personalie">Gambisbre PersonalierG8rbi<' />> Gardezrna>">/" e<' />>
> "Ho-Chi-Minh-Saadtref="http://de.wikiactu.com724y>+xml" tFu93zimağuva">Gazimağuvarna>">/" e<' />> > "Hobarthref="http://de.wikiactu.com3655"m+xml" t668ball-2.Bundesliga dt. (Spielbericht)ytF6689b<' />> "Hoboken (New J-rs-y)href="http://de.wikiactu.com4871ym+xml" tG62apagosinseln">Galapagosinselnrna>">/" e> "Hochge0ytwindigkeitsverkehrhref="http://de.wikiactu.com5350y>+xml" t354a (Stadt)">Gaza (Stadt)rna>">/" e<' />> 35ßbv clre-iHoythausbrnem lHoythausbrnemhref="http://de.wikiactu.com8170ym+xml" t55ßball-Weltmeivtersbraft der Frauen 2011y55ßbv clre-iHoytre-ule allg.neHoytre-ule allg.ref="http://de.wikiactu.com741"m+xml" tGa88Are Roger">Frère Rogerrna>">/" e<' />> 889iee-inem-2Hoytre-ule für Musik Franz Liszt WeimarneHoytre-ule für Musik Franz Liszt Weimarref="http://de.wikiactu.com741"m+xml" tGal6iball-2.Bundesliga dt. (Spielbericht)ytFl6ibe-inem-2Hoytre-ule Furtwangen Univlesitym Hoytre-ule Furtwangen Univlesityhref="http://de.wikiactu.com2473"m+xml" t12xy 15"tGalaxy 15rna>">/" e<' />>
Gambisbre Politikrna>">/709iee-inem-2Hoytre-ulrektorenkonfeinnz>"Hoytre-ulrektorenkonfeinnzref="http://de.wikiactu.com741"m+xml" tGal21imağuva">Gazimağuvarna>">/" e<' />> "Hoyttiefhref="http://de.wikiactu.com5350y>+xml" t344a (Stadt)">Gaza (Stadt)rna>">/" e<' />> 34ßbv clre-iHoytvlerat lHoytvlerathref="http://de.wikiactu.com2473"m+xml" t128ball-2.Bundesliga dt. (Spielbericht)ytF128bv clre-iHoytwkiaerneHoytwkiaerhref="http://de.wikiactu.com4871ym+xml" tG0ball allg.">Fußball allg.rna>">/" e<' /40bae-inem-2Hoytzemt lHoytzemthref="http://de.wikiactu.com2473"m+xml" tG7ßball-2.Bundesliga dt. (Spielbericht)ytFG7ibe-inem-2Hoykennem- lHoykennem-href="http://de.wikiactu.com2473"m+xml" t71un Politik">Gabun Politikrna>">/" e<' />7191be-inem-2Hoykey lHoykeyhref="http://de.wikiactu.com2473"m+xml" t968eries Lafayette"tGaleries Lafayetterna>"968ere-inem-2Hoeytrt AG lHoeytrt AGref="http://de.wikiactu.com741"m+xml" tGa85mball-1.Liga SlowakeiytFußball-1.Liga S85mbe-inem-2Hoeem-rloo lHoeem-rlooref="http://de.wikiactu.com741"m+xml" tGa844ileo Galilei">Galileo Galileirna>">/" e<844ile-inem-2Hof>"Hofhref="http://de.wikiactu.com5350y>+xml" t35ank-Jürgen Weise">Frank-Jürgen Weiserna35anke-inem-2Hohenemsm Hohenemsref="http://de.wikiactu.com741"m+xml" tGa82ßballtrainer">Fußballtrainerrna>">/" e<82ßb e<' />>Hohenhameln-4Hohenhamelnref="http://de.wikiactu.com741"m+xml" tGa882tstättenbrand">Gaststättenbrandrna>">/8823bv clre-iHohenstein-4Hohensteinhref="http://de.wikiactu.com3655"m+xml" t67teries Lafayette"tGaleries Lafayetterna>"67terv clre-iHohn (Sinleswig-Holstein)>"Hohn (Sinleswig-Holstein)ref="http://de.wikiactu.com724y>+xml" tFu92bisbre Personalie">Gambisbre Personalier92biv clre-iHol"26lerv clre-iHol"603erv clre-iHollenstedt>"Hollenstedthref="http://de.wikiactu.com8170ym+xml" t52ball-Europameivtersbraft 2008ytFußball52be-inem-2Hollywood (Florida)>"Hollywood (Florida)href="http://de.wikiactu.com3655"m+xml" t14rball allg.">Fußball allg.rna>">/" e<' /14rbae-inem-2Holocaust>"Holocausthref="http://de.wikiactu.com2473"m+xml" tG43al Mubarak">Gamal Mubarakrna>">/" e<' />G433re-inem-2Holocaustleugnuegm Holocaustleugnuegref="http://de.wikiactu.com724y>+xml" tFu912apagosinseln">Galapagosinselnrna>">/" e<912ap<' />> Fußball allg.rna>">/" e<' /l00a<' />> "Holzkirchen (Otlebayern)href="http://de.wikiactu.com5350y>+xml" t941xy 15"tGalaxy 15rna>">/" e<' />>
"Homborihref="http://de.wikiactu.com2473"m+xml" tG0mbisbre Personalie">Gambisbre PersonalierG0mbie-inem-2Homosexualität>"Homosexualitätref="http://de.wikiactu.com741"m+xml" tGal6tiburg im Üechtland">Freiburg im Üechtl7682re-inem-2Homsm Homsref="http://de.wikiactu.com741"m+xml" tGa522ileo Galilei">Galileo Galileirna>">/" e<522il e<' />>Hondam Hondaref="http://de.wikiactu.com724y>+xml" tFu94al Mubarak">Gamal Mubarakrna>">/" e<' />949ts e<' />>Honduras4yHondurashref="http://de.wikiactu.com3655"m+xml" t156dez">Gardezrna>">/" e<' />>
>Hongkongm Hongkonghref="http://de.wikiactu.com4871ym+xml" tG97ball allg.">Fußball allg.rna>">/" e<' /497ba e<' />>Honiaram Honiarahref="http://de.wikiactu.com3655"m+xml" t157ball allg.">Fußball allg.rna>">/" e<' /157ba e<' />>Honigbienem Honigbieneref="http://de.wikiactu.com741"m+xml" tGa50dolfing">Fridolfingrna>">/" e<' />> Fußball-BunG08be-inem-2Hörfunkmedia m Hörfunkmedia ref="http://de.wikiactu.com724y>+xml" tFu98bisbre Personalie">Gambisbre Personalier98biv clre-iHörspielmusik-1Hörspielmusikhref="http://de.wikiactu.com4871ym+xml" t656bisbre Politik">Gambisbre Politikrna>">/656bie-inem-2Horrt Arnolm lHorrt Arnolmhref="http://de.wikiactu.com4871ym+xml" tG6apagosinseln">Galapagosinselnrna>">/" eGardezrna>">/" e<' />>
Gary Moorerna>">/" e<' />> Fußballtrainerrna>">/" e>Horrt SeehoferneHorrt Seehoferhref="http://de.wikiactu.com8170ym+xml" t55eballländerspielytFußballländerspielr55eb e<' />>Horrt Tappert>"Horrt Tappertref="http://de.wikiactu.com724y>+xml" tFu7820ytG-20rna>">/" e<' />>
"Hoschyar Zrbariref="http://de.wikiactu.com724y>+xml" tFu93eballländerspielytFußballländerspielr93ebv clre-iHot Bird 3>"Hot Bird 3ref="http://de.wikiactu.com724y>+xml" tFu937ball-2.Bundesliga dt. (Spielbericht)ytFA37bv clre-iHot Bird 8>"Hot Bird 8ref="http://de.wikiactu.com386y>+xml" tFu699dolfing">Fridolfingrna>">/" e<' />> "Hot Bird 9href="http://de.wikiactu.com1214y>+xml" tG78ball-Bundesliga dt. allg.">Fußball-BunG78bv clre-iHot4lm Hoi4lhref="http://de.wikiactu.com8170ym+xml" t116ileo Galilei">Galileo Galileirna>">/" e<116ilv clre-iHot4lbrnem lHot4lbrnemhref="http://de.wikiactu.com8170ym+xml" t11bisbre Personalie">Gambisbre Personalier11biv clre-iHot4llerie und Restauration-4Hot4llerie und Restaurationhref="http://de.wikiactu.com2473"m+xml" tG0rdez">Gardezrna>">/" e<' />>
Garbring b.Münbrenrna91bbrv clre-iHövelhomlrHövelhomhref="http://de.wikiactu.com5350y>+xml" t264imağuva">Gazimağuvarna>">/" e<' />> <5HughesneHow"><5Hughesref="http://de.wikiactu.com386y>+xml" tFu61leries Lafayette"tGaleries Lafayetterna>"61lerv clre-iHoyam Hoyaref="http://de.wikiactu.com741"m+xml" tGal83ball allg.">Fußball allg.rna>">/" e<' /783ba e<' />>Hoyvík-1Hoyvíkhref="http://de.wikiactu.com5350y>+xml" t34tstättenbrand">Gaststättenbrandrna>">/34tse-inem-2HR-1HRref="http://de.wikiactu.com386y>+xml" tFu69ddolfing">Fridolfingrna>">/" e<' />> Gambisbre Personalier65bie-inem-2Hsin-Tien Citym Hsin-Tien Cityhref="http://de.wikiactu.com4871ym+xml" tG4iedrich II. (Preußen)ytFriedrich II. (PrG4iede-inem-2Hsinchum Hsinchuhref="http://de.wikiactu.com7506y>+xml" t68ddolfing">Fridolfingrna>">/" e<' />> Fridolfingrna>">/" e<' />> ">/" e<' />>
"59aere-inem-2Hutlet Ulrem lrHutlet Ulrem ref="http://de.wikiactu.com741"m+xml" tGa828re Roger">Frère Rogerrna>">/" e<' />> 828re-inem-2Hutletus Heii-4Hutletus Heiihref="http://de.wikiactu.com4871ym+xml" tG33bisbre Politik">Gambisbre Politikrna>">/G33bie-inem-2Hutletus Sinmolmt-4Hutletus Sinmolmtref="http://de.wikiactu.com741"m+xml" tGal29ball allg.">Fußball allg.rna>">/" e<' /729bae-inem-2Hutschrautle-4Hutschrautlehref="http://de.wikiactu.com1214y>+xml" tG7ball-Bundesliga dt. allg.">Fußball-BunG75ae-inem-2Hutschrautle allg.neHutschrautle allg.href="http://de.wikiactu.com4871ym+xml" tG62bisbre Personalie">Gambisbre PersonalierG6mbie-inem-2Huddersfield4yHuddersfieldhref="http://de.wikiactu.com2473"m+xml" t964un Politik">Gabun Politikrna>">/" e<' />9641bv clre-iHuem Hueref="http://de.wikiactu.com724y>+xml" tFu95rbisbre Personalie">Gambisbre Personalier95rbiv clre-iHüftgelenkschada m Hüftgelenkschada href="http://de.wikiactu.com5350y>+xml" t3nk-Jürgen Weise">Frank-Jürgen Weiserna3dov clre-iHugo Chávez>"Hugo Chávezhref="http://de.wikiactu.com5350y>+xml" t220dolfing">Fridolfingrna>">/" e<' />> Gambisbre Personalier952biv clre-iHumayun Khan-4Humayun Khanhref="http://de.wikiactu.com7506y>+xml" t626bisbre Politik">Gambisbre Politikrna>">/626bie-inem-2Humbolmt-Univlesität zu Beelin-4Humbolmt-Univlesität zu Beelinhref="http://de.wikiactu.com1214y>+xml" tG82ileo Galilei">Galileo Galileirna>">/" e<1829re-inem-2Huem lHuemhref="http://de.wikiactu.com8170ym+xml" t681imağuva">Gazimağuvarna>">/" e<' />> Gaza (Stadt)rna>">/" e<' />> 974a e-inem-2Hueti>"Hueti>Gazimağuvarna>">/" e<' />> "Huetsville (Texas)href="http://de.wikiactu.com4871ym+xml" tG6rdez">Gardezrna>">/" e<' />>
"258dee-inem-2Hunrikan-4Hunrikanhref="http://de.wikiactu.com4871ym+xml" tG97all allg.">Fußball allg.rna>">/" e<' /497ee-inem-2Hunrikan Katrina-4Hunrikan Katrinahref="http://de.wikiactu.com2473"m+xml" tG0rre Roger">Frère Rogerrna>">/" e<' />> G047ee-inem-2Hunrikan Rita-1Hunrikan Ritahref="http://de.wikiactu.com5350y>+xml" t3z2ileo Galilei">Galileo Galileirna>">/" e<3z2ile-inem-2Hunrikan Wilma-1Hunrikan Wilmaref="http://de.wikiactu.com741"m+xml" tGa809bisbre Politik">Gambisbre Politikrna>">/8097ee-inem-2Huntigrut-n-4Huntigrut-nref="http://de.wikiactu.com741"m+xml" tGa858ball-Bundesliga dt. allg.">Fußball-Bun858be-inem-2Husain ascl-Sinahristani>"Husain ascl-Sinahristaniref="http://de.wikiactu.com741"m+xml" tGal82ileo Galilei">Galileo Galileirna>">/" e<7829re-inem-2Hüseyin-Kenan Aydi m Hüseyin-Kenan Aydi ref="http://de.wikiactu.com724y>+xml" tFu943al Mubarak">Gamal Mubarakrna>">/" e<' />9433re-inem-2Hussein Badruddin al-Huthi>"Hussein Badruddin al-Huthiref="http://de.wikiactu.com724y>+xml" tFu913al Mubarak">Gamal Mubarakrna>">/" e<' />9133re-inem-2Husum>"Husumref="http://de.wikiactu.com741"m+xml" tGal72ileo Galilei">Galileo Galileirna>">/" e<7729re-inem-2Hülre-enhausa m Hülre-enhausa href="http://de.wikiactu.com4871ym+xml" tG8a (Stadt)">Gaza (Stadt)rna>">/" e<' />> 4835re-inem-2Hült-ngrna (Kärnt-n)m Hült-ngrna (Kärnt-n)href="http://de.wikiactu.com1214y>+xml" t792dez">Gardezrna>">/" e<' />>
">/" e<' />> Gardezrna>">/" e<' />>
Gardezrna>">/" e<' />>
Frank-Jürgen Weiserna98anke-inem-2Hymir-1Hymirhref="http://de.wikiactu.com2473"m+xml" t958ball-Bundesliga dt. allg.">Fußball-Bun958be-inem-2Hyperostose-3Hyperostoseref="http://de.wikiactu.com724y>+xml" tFu95rball in Liebrtenstei=">Fußball in Lieb957bie-inem-2Hypervitaminose-3Hypervitaminoseref="http://de.wikiactu.com741"m+xml" tGa523bisbre Politik">Gambisbre Politikrna>">/523bie-inem-2IAA Nutzfahrzeuge-3IAA Nutzfahrzeugeref="http://de.wikiactu.com741"m+xml" tGal4rbring b.Münbren">Garbring b.Münbrenrna74rbr e<' />>IAAF-3IAAFref="http://de.wikiactu.com741"m+xml" tGal73nk-Jürgen Weise">Frank-Jürgen Weisernal73nk e<' />>IAB-3IABref="http://de.wikiactu.com741"m+xml" tGa83dez">Gardezrna>">/" e<' />>
Gaza (Stadt)rna>">/" e<' />> 124a e-inem-2Iajuddin Ahmed-1Iajuddin Ahmedhref="http://de.wikiactu.com5350y>+xml" t332bisbre Politik">Gambisbre Politikrna>">/332bie-inem-2Ian Wilmut-1Ian Wilmutref="http://de.wikiactu.com724y>+xml" tFu592ball allg.">Fußball allg.rna>">/" e<' /592bae-inem-2IapetusneIapetusref="http://de.wikiactu.com741"m+xml" tGa882dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />594unv clre-iIBB-3IBBref="http://de.wikiactu.com741"m+xml" tGa34al Mubarak">Gamal Mubarakrna>">/" e<' />34alv clre-iIbb-ngüra m Ibb-ngüra href="http://de.wikiactu.com1214y>+xml" tG71xy 15"tGalaxy 15rna>">/" e<' />>
Gazimağuvarna>">/" e<' />> Gambisbre Politikrna>">/311biv clre-iIbrahm- al-Dsinafari>"Ibrahm- al-Dsinafariref="http://de.wikiactu.com724y>+xml" tFu95ball-Bundesliga dt. allg.">Fußball-Bun955iv clre-iIbrahm- Gambari>"Ibrahm- Gambarihref="http://de.wikiactu.com2473"m+xml" tG5rbisbre Personalie">Gambisbre Personalier25rbiv clre-iIbrahm- Rugova>"Ibrahm- Rugovahref="http://de.wikiactu.com4871ym+xml" tG7rxy 15"tGalaxy 15rna>">/" e<' />>
"ICANNhref="http://de.wikiactu.com2473"m+xml" t124edrich II. (Preußen)ytFriedrich II. (Pr12rbr e<' />>ICAO>"ICAOref="http://de.wikiactu.com724y>+xml" tFu172bisbre Politik">Gambisbre Politikrna>">/172bi e<' />>ICCN>"ICCNhref="http://de.wikiactu.com2473"m+xml" t61rball-Weltmeivtersbraft der Frauen 2011y6172re-inem-2IceBridge-3IceBridgehref="http://de.wikiactu.com2473"m+xml" tG4un Politik">Gabun Politikrna>">/" e<' />G4une-inem-2Icelnem Express-3Icelnem Expresshref="http://de.wikiactu.com4871ym+xml" tG1rxy 15"tGalaxy 15rna>">/" e<' />>
">/" e<' />>
Gambisbre Personalier75rbiv clre-iIch-AG lIch-AGref="http://de.wikiactu.com741"m+xml" tGa382ball allg.">Fußball allg.rna>">/" e<' /382bav clre-iIdar-Otlestein-4Idar-Otlesteinhref="http://de.wikiactu.com3655"m+xml" t15bisbre Personalie">Gambisbre Personalier15biv clre-iIdentifikationstechnik-1Identifikationstechnikref="http://de.wikiactu.com741"m+xml" tGa89termittelhersteller">Futtermittelherstel89tee-inem-2Identität, Tradi-ine, Souveränität>"Identität, Tradi-ine, Souveränitätref="http://de.wikiactu.com724y>+xml" tFu594ball allg.">Fußball allg.rna>">/" e<' /594bav clre-iIdstein-4Idsteinhref="http://de.wikiactu.com3655"m+xml" t97miburg im Üechtland">Freiburg im Üechtl97mibv clre-iIfop-4Ifopref="http://de.wikiactu.com741"m+xml" tGa859bisbre Politik">Gambisbre Politikrna>">/85Are-inem-2Ifremir-1Ifremirref="http://de.wikiactu.com741"m+xml" tGa859ileo Galilei">Galileo Galileirna>">/" e<8599re-inem-2IfW-1IfWref="http://de.wikiactu.com724y>+xml" tFu93ßball in KroatienytFußball in Kroatienr93ßbe-inem-2IG Airport Taxi>"IG Airport Taxihref="http://de.wikiactu.com2473"m+xml" t12al Mubarak">Gamal Mubarakrna>">/" e<' />12ale-inem-2IG BAU-4IG BAUhref="http://de.wikiactu.com5350y>+xml" t228re Roger">Frère Rogerrna>">/" e<' />> 228re-inem-2IG BCE-4IG BCEhref="http://de.wikiactu.com4871ym+xml" tG33a (Stadt)">Gaza (Stadt)rna>">/" e<' />> 433be-inem-2IG Chemie-4IG Chemieref="http://de.wikiactu.com741"m+xml" tGa52teries Lafayette"tGaleries Lafayetterna>"52terv clre-iIGH-4IGHhref="http://de.wikiactu.com1214y>+xml" tG3ball allg.">Fußball allg.rna>">/" e<' /G3bav clre-iIGM-3IGMref="http://de.wikiactu.com741"m+xml" tGa77zun Politik">Gabun Politikrna>">/" e<' />7761ie-inem-2Ignaz Walter-1Ignaz Walterref="http://de.wikiactu.com724y>+xml" tFu93xy 15"tGalaxy 15rna>">/" e<' />>
Galileo Galileirna>">/" e<7739b<' />> ental Cup-4IIHF Coeti>ental Cupref="http://de.wikiactu.com741"m+xml" tGal26iburg im Üechtland">Freiburg im Üechtll26ib<' />> Fußball allg.rna>">/" e<' /600bav clre-iIKRK-4IKRKref="http://de.wikiactu.com741"m+xml" tGa85rball in Liebrtenstei=">Fußball in Lieb857bie-inem-2Iksan-4Iksanref="http://de.wikiactu.com724y>+xml" tFu980ball allg.">Fußball allg.rna>">/" e<' /980bae-inem-2Iljusinin-4Iljusininhref="http://de.wikiactu.com5350y>+xml" t218eries Lafayette"tGaleries Lafayetterna>"218dee-inem-2Illegale Abholzuegm Illegale Abholzueghref="http://de.wikiactu.com5350y>+xml" t213a (Stadt)">Gaza (Stadt)rna>">/" e<' />> 213a e-inem-2Illegale Einwanderuegm Illegale Einwanderueghref="http://de.wikiactu.com5350y>+xml" t218a (Stadt)">Gaza (Stadt)rna>">/" e<' />> 218a e-inem-2Illegaler Handelm Illegaler Handelhref="http://de.wikiactu.com2473"m+xml" t647bisbre Politik">Gambisbre Politikrna>">/647bie-inem-2Illinoism Illinoishref="http://de.wikiactu.com2473"m+xml" t121dez">Gardezrna>">/" e<' />>
Freiburg im Üechtl57tibe-inem-2Ilmkreism Ilmkreisref="http://de.wikiactu.com741"m+xml" tGal7un Politik">Gabun Politikrna>">/" e<' />77une-inem-2ILO>"ILOref="http://de.wikiactu.com724y>+xml" tFu700ileo Galilei">Galileo Galileirna>">/" e<700ile-inem-2Ilse Aignarm Ilse Aignarhref="http://de.wikiactu.com8170ym+xml" t6842pagosinseln">Galapagosinselnrna>">/" e<684ede-inem-2Ilshoma m Ilshoma ref="http://de.wikiactu.com741"m+xml" tGa34bisbre Politik">Gambisbre Politikrna>">/34ère-inem-2Imolam Imolaref="http://de.wikiactu.com741"m+xml" tGa77zbisbre Politik">Gambisbre Politikrna>">/776re-inem-2Impfuegm Impfueghref="http://de.wikiactu.com8170ym+xml" t66un Politik">Gabun Politikrna>">/" e<' />669xye-inem-2ImpressineismusneImpressineismushref="http://de.wikiactu.com4871ym+xml" tG5xball-2.Bundesliga dt. (Spielbericht)ytF45xbe-inem-2Iñaki Urdangarin-4Iñaki Urdangarinref="http://de.wikiactu.com741"m+xml" tGa312apagosinseln">Galapagosinselnrna>">/" e<312ap<' />> Gambisbre Politikrna>">/97bi<' />> Gambisbre Politikrna>">/901bi<' />> Gardezrna>">/" e<' />>
">/" e<' />>
Galileo Galileirna>">/" e<313ilv clre-iIndi0ytir Ozean-4Indi0ytir Ozeanref="http://de.wikiactu.com741"m+xml" tGa381ball allg.">Fußball allg.rna>">/" e<' /3814lv clre-iIndividualethik-1Individualethikref="http://de.wikiactu.com741"m+xml" tGa77ttermittelhersteller">Futtermittelherstell7ebv clre-iIndonesi0ytis Militärwesa m Indonesi0ytis Militärwesa ref="http://de.wikiactu.com741"m+xml" tGa523eries Lafayette"tGaleries Lafayetterna>"523dev clre-iIndustriepreism Industriepreisref="http://de.wikiactu.com741"m+xml" tGa719dolfing">Fridolfingrna>">/" e<' />> ">/" e<' />>
Freiburg im Üechtl196ib e<' />>Informationsfreinemtsgesetzm Informationsfreinemtsgesetzref="http://de.wikiactu.com741"m+xml" tGal80un Politik">Gabun Politikrna>">/" e<' />780un e<' />>Informationstechniku>ternehma m Informationstechniku>ternehma href="http://de.wikiactu.com8170ym+xml" t68ttermittelhersteller">Futtermittelherstel68ebv clre-iInfratest dimapm Infratest dimapref="http://de.wikiactu.com724y>+xml" tFu94l Mubarak">Gamal Mubarakrna>">/" e<' />94bv clre-iInge Kloepf4rm Inge Kloepf4rhref="http://de.wikiactu.com2473"m+xml" tG4re Roger">Frère Rogerrna>">/" e<' />> G4Are-inem-2Ingeborg-Bachman -Preism Ingeborg-Bachman -Preishref="http://de.wikiactu.com1214y>+xml" tG84ball allg.">Fußball allg.rna>">/" e<' /G844bv clre-iIngelore Rosa kött4rm Ingelore Rosa kött4rref="http://de.wikiactu.com741"m+xml" tGa87al Mubarak">Gamal Mubarakrna>">/" e<' />87ale-inem-2Ingenieurgürom Ingenieurgürohref="http://de.wikiactu.com2473"m+xml" tG79ileo Galilei">Galileo Galileirna>">/" eFrank-Jürgen Weiserna813nke-inem-2Ingo Wolfm Ingo Wolfhref="http://de.wikiactu.com5350y>+xml" t3nAeries Lafayette"tGaleries Lafayetterna>"3nAere-inem-2Ingolf Roßbrna>"Ingolf Roßbrnaref="http://de.wikiactu.com741"m+xml" tGa882ez">Gardezrna>">/" e<' />>
"Ingolsaadthref="http://de.wikiactu.com5350y>+xml" t378ball-1.Liga SlowakeiytFußball-1.Liga S3789b<' />> <Íngrid Betancourt>"Íngrid Betancourtref="http://de.wikiactu.com741"m+xml" tGa84rball allg.">Fußball allg.rna>">/" e<' /8444bv clre-iIngrid Steeg4rm Ingrid Steeg4rhref="http://de.wikiactu.com5350y>+xml" t33ßballtrainer">Fußballtrainerrna>">/" e<33ßb e<' />>Inline-Skata m Inline-Skata href="http://de.wikiactu.com5350y>+xml" t33ßball-2.Bundesliga dt. (Spielbericht)ytF333ilv clre-iInlinehoykey lInlinehoykeyhref="http://de.wikiactu.com5350y>+xml" t334un Politik">Gabun Politikrna>">/" e<' />334unv clre-iInnenmieist4rkonfeinnz>"Innenmieist4rkonfeinnzhref="http://de.wikiactu.com2473"m+xml" tG86iburg im Üechtland">Freiburg im ÜechtlG86ibv clre-iInnenpolitik-1Innenpolitikhref="http://de.wikiactu.com1214y>+xml" t58ball-Bundesliga dt. allg.">Fußball-Bun58be-inem-2Innenpolitik in Deutsinlnem lInnenpolitik in Deutsinlnemhref="http://de.wikiactu.com1214y>+xml" t51bisbre Politik">Gambisbre Politikrna>">/51bi<' />> +xml" t3nmiburg im Üechtland">Freiburg im Üechtl3nmib<' />> "G8ler<' />> Gamal Mubarakrna>">/" e<' />75ale-inem-2Insat 4A-4Insat 4Ahref="http://de.wikiactu.com2473"m+xml" t649ileo Galilei">Galileo Galileirna>">/" e<649ile-inem-2Insekt>"Insekthref="http://de.wikiactu.com1214y>+xml" t503un Politik">Gabun Politikrna>">/" e<' />503une-inem-2Insiderhandelm Insiderhandelref="http://de.wikiactu.com724y>+xml" tFu93al Mubarak">Gamal Mubarakrna>">/" e<' />93ale-inem-2Insolvnnz>"Insolvnnzhref="http://de.wikiactu.com5350y>+xml" t327ball-Bundesliga dt. allg.">Fußball-Bun327be-inem-2Insolvnnzree-ineInsolvnnzree-ihref="http://de.wikiactu.com7506y>+xml" t623ball allg.">Fußball allg.rna>">/" e<' /623bae-inem-2Ins-inut der deulre-en WirtsinaftneIns-inut der deulre-en Wirtsinafthref="http://de.wikiactu.com2473"m+xml" tG0ßball-Weltmeivtersbraft der Frauen 2011yG0ßbe-inem-2Ins-inut für Demoskopie Allensbam lrIns-inut für Demoskopie Allensbam ref="http://de.wikiactu.com741"m+xml" tGa520all allg.">Fußball allg.rna>">/" e<' /520ae-inem-2Ins-inut für Enrnaie- und Umweltfe-re-ung Heidelbrna>"Ins-inut für Enrnaie- und Umweltfe-re-ung Heidelbrnahref="http://de.wikiactu.com3655"m+xml" t909dolfing">Fridolfingrna>">/" e<' />> "Intelsat Amar3eas 8href="http://de.wikiactu.com3655"m+xml" t96ileo Galilei">Galileo Galileirna>">/" e<969oe-inem-2Inter Mailnem lInter Mailnemhref="http://de.wikiactu.com2473"m+xml" t6002pagosinseln">Galapagosinselnrna>">/" e<60ßbe-inem-2Intercitym Intercityhref="http://de.wikiactu.com2473"m+xml" t6094l Mubarak">Gamal Mubarakrna>">/" e<' />6094le-inem-2InterCityExpress-3InterCityExpresshref="http://de.wikiactu.com3655"m+xml" t151xy 15"tGalaxy 15rna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />393ale-inem-2International AirServicem International AirServicehref="http://de.wikiactu.com4871ym+xml" tG802pagosinseln">Galapagosinselnrna>">/" eGalileo Galileirna>">/" e<560ile-inem-2Internationale Funkausstellueg Beelin-4Internationale Funkausstellueg Beelinhref="http://de.wikiactu.com2473"m+xml" t694ileo Galilei">Galileo Galileirna>">/" e<694ile-inem-2Internationale Luft- und Raumfahrtausstellueg Beelin-4Internationale Luft- und Raumfahrtausstellueg Beelinref="http://de.wikiactu.com741"m+xml" tGa8260n Politik">Gabun Politikrna>">/" e<' />8260ne-inem-2Internationale Rotkreuz- und Rothalbmond-Beweguegm Internationale Rotkreuz- und Rothalbmond-Beweguegref="http://de.wikiactu.com741"m+xml" tGal7al Mubarak">Gamal Mubarakrna>">/" e<' />779ale-inem-2Internationaler Bookerpreism Internationaler Bookerpreisref="http://de.wikiactu.com724y>+xml" tFu98Aeries Lafayette"tGaleries Lafayetterna>"98Aere-inem-2Internationaler Gewerksinaftsbuem lInternationaler Gewerksinaftsbuemhref="http://de.wikiactu.com4871ym+xml" tG09ileo Galilei">Galileo Galileirna>">/" eGamal Mubarakrna>">/" e<' />G53ale-inem-2Internationaler StrafGambisbre Politikrna>">/527bie-inem-2Internationaler StrafGazimağuvarna>">/" e<' />> Frank-Jürgen Weiserna9910ne-inem-2Internationaler Währuegsfondsm Internationaler Währuegsfondshref="http://de.wikiactu.com4871ym+xml" tG7ball allg.">Fußball allg.rna>">/" e<' /474le-inem-2Internet allg.neInternet allg.href="http://de.wikiactu.com2473"m+xml" t6ßball-2.Bundesliga dt. (Spielbericht)ytF6ibe-inem-2Internet-AngebotneInternet-Angebotref="http://de.wikiactu.com741"m+xml" tGa381un Politik">Gabun Politikrna>">/" e<' />381xyv clre-iInternetdia stanbiet4rm Internetdia stanbiet4rhref="http://de.wikiactu.com2473"m+xml" tG42ileo Galilei">Galileo Galileirna>">/" eGamal Mubarakrna>">/" e<' />113ale-inem-2Internetree-ineInternetree-iref="http://de.wikiactu.com741"m+xml" tGa31rball-Weltmeivtersbraft der Frauen 2011y3172re-inem-2Internetu>ternehma m Internetu>ternehma href="http://de.wikiactu.com3655"m+xml" t973a (Stadt)">Gaza (Stadt)rna>">/" e<' />> 973a e-inem-2Interorbital Systemsm Interorbital Systemshref="http://de.wikiactu.com5350y>+xml" t3nAnk-Jürgen Weise">Frank-Jürgen Weiserna3d9doe-inem-2Interpolm Interpolref="http://de.wikiactu.com741"m+xml" tGa88zbisbre Politik">Gambisbre Politikrna>">/88zbie-inem-2InterSkym InterSkyref="http://de.wikiactu.com724y>+xml" tFu94edrich II. (Preußen)ytFriedrich II. (Pr94ede-inem-2Inves-inion-4Inves-inionhref="http://de.wikiactu.com4871ym+xml" tG30bisbre Politik">Gambisbre Politikrna>">/G30bie-inem-2InzesineInzesiref="http://de.wikiactu.com741"m+xml" tGal3ßballtrainer">Fußballtrainerrna>">/" e<73ßb e<' />>Ioannis Amanatidism Ioannis Amanatidishref="http://de.wikiactu.com5350y>+xml" t218bisbre Personalie">Gambisbre Personalier21bie-inem-2IOC-4IOChref="http://de.wikiactu.com3655"m+xml" t74ball allg.">Fußball allg.rna>">/" e<' /74bae-inem-2IOC-Labor-4IOC-Laborref="http://de.wikiactu.com741"m+xml" tGal7rre Roger">Frère Rogerrna>">/" e<' />> l7rre-inem-2IOC-Vollvlesammlueg Nr. 11bisIOC-Vollvlesammlueg Nr. 11bref="http://de.wikiactu.com741"m+xml" tGal7ra (Stadt)">Gaza (Stadt)rna>">/" e<' />> 774a e-inem-2IOC-Vollvlesammlueg Nr. 118isIOC-Vollvlesammlueg Nr. 118href="http://de.wikiactu.com3655"m+xml" t77rdez">Gardezrna>">/" e<' />>
Fußball allg.rna>">/" e<' /26rbae-inem-2IÖD-4IÖDref="http://de.wikiactu.com741"m+xml" tGa871al Mubarak">Gamal Mubarakrna>">/" e<' />871ale-inem-2Iowa-4Iowaref="http://de.wikiactu.com741"m+xml" tGa892ball-Europameivtersbraft 2008ytFußball892be-inem-2Iowa Citym Iowa Cityhref="http://de.wikiactu.com1214y>+xml" tG3ball allg.">Fußball allg.rna>">/" e<' /G3bae-inem-2IPCC-4IPCCref="http://de.wikiactu.com741"m+xml" tGal5un Politik">Gabun Politikrna>">/" e<' />7xye-inem-2IPSTAR-4IPSTARref="http://de.wikiactu.com724y>+xml" tFu9371y 15"tGalaxy 15rna>">/" e<' />>
Garbring b.Münbrenrna39bbre-inem-2Ipswem (Quea slnem)lrIpswem (Quea slnem)href="http://de.wikiactu.com5350y>+xml" t393eries Lafayette"tGaleries Lafayetterna>"39aere-inem-2Iquitosm Iquitosref="http://de.wikiactu.com741"m+xml" tGa524imağuva">Gazimağuvarna>">/" e<' />> Gambisbre Politikrna>">/781bie-inem-2Iraki0yti Außenpolitik-1Iraki0yti Außenpolitikhref="http://de.wikiactu.com3655"m+xml" t90zimağuva">Gazimağuvarna>">/" e<' />> > Gazimağuvarna>">/" e<' />> > ">/" e<' />>
Fußball allg.rna>">/" e<' /526bav clre-iIrani0yti Außenpolitik-1Irani0yti Außenpolitikhref="http://de.wikiactu.com4871ym+xml" tG10dolfing">Fridolfingrna>">/" e<' />> Frère Rogerrna>">/" e<' />> 398rv clre-iIrkutsk-1Irkutskhref="http://de.wikiactu.com3655"m+xml" t923ball-2.Bundesliga dt. (Spielbericht)ytFA23ilv clre-iIrmg"><5Hesse-4Irmg"><5Hessehref="http://de.wikiactu.com4871ym+xml" tG6tbisbre Politik">Gambisbre Politikrna>">/G6tbiv clre-iIrre-enbrna>"Irre-enbrnaref="http://de.wikiactu.com741"m+xml" tGa529ileo Galilei">Galileo Galileirna>">/" e<529ilv clre-iIsaac HayesneIsaac Hayesref="http://de.wikiactu.com741"m+xml" tGa31bbring b.Münbren">Garbring b.Münbrenrna31bbrv clre-iIsabel AllendeneIsabel Allenderef="http://de.wikiactu.com741"m+xml" tGa523imağuva">Gazimağuvarna>">/" e<' />> >Isabell WerthneIsabell Werthref="http://de.wikiactu.com741"m+xml" tGa57eries Lafayette"tGaleries Lafayetterna>"5terv clre-iISAF-3ISAFref="http://de.wikiactu.com741"m+xml" tGal32ball allg.">Fußball allg.rna>">/" e<' /l32ba e<' />>Isayas AfewerkineIsayas Afewerkihref="http://de.wikiactu.com4871ym+xml" tG77ball-Bundesliga dt. allg.">Fußball-BunG77b e<' />>Ise-ewsk-1Ise-ewskhref="http://de.wikiactu.com2473"m+xml" t6794l Mubarak">Gamal Mubarakrna>">/" e<' />6794le-inem-2Ischmasm lrIschmasm href="http://de.wikiactu.com3655"m+xml" t111a (Stadt)">Gaza (Stadt)rna>">/" e<' />> 111a e-inem-2Iselin-4Iselinhref="http://de.wikiactu.com5350y>+xml" t213un Politik">Gabun Politikrna>">/" e<' />G13une-inem-2Is-rlohn-4Iserlohnhref="http://de.wikiactu.com3655"m+xml" t903imağuva">Gazimağuvarna>">/" e<' />> Fußball-Bun875bv clre-iISI-4ISIhref="http://de.wikiactu.com4871ym+xml" tG6mball-1.Liga SlowakeiytFußball-1.Liga SG6mbe-inem-2Isirom Isiroref="http://de.wikiactu.com724y>+xml" tFu953nk-Jürgen Weise">Frank-Jürgen Weiserna953nkv clre-iISIS-4ISIShref="http://de.wikiactu.com4871ym+xml" t67ttermittelhersteller">Futtermittelherstel67ebv clre-iIskenderuem Iskenderuehref="http://de.wikiactu.com5350y>+xml" t3z4ileo Galilei">Galileo Galileirna>">/" e<3z4ilv clre-iIsla Margarita-1Isla Margaritahref="http://de.wikiactu.com2473"m+xml" t693un Politik">Gabun Politikrna>">/" e<' />693unv clre-iIslam in Asia m Islam in Asia ref="http://de.wikiactu.com741"m+xml" tGa5G7ball allg.">Fußball allg.rna>">/" e<' /5474le-inem-2Islam in Deutsinlnem lIslam in Deutsinlnemref="http://de.wikiactu.com741"m+xml" tGa57ebisbre Politik">Gambisbre Politikrna>">/576re-inem-2Islam in Europa lIslam in Europahref="http://de.wikiactu.com3655"m+xml" t740bisbre Politik">Gambisbre Politikrna>">/740bie-inem-2Islam in Frankreim lrIslam in Frankreim ref="http://de.wikiactu.com724y>+xml" tFu98edrich II. (Preußen)ytFriedrich II. (Pr982re-inem-2IslamabadlrIslamabadhref="http://de.wikiactu.com3655"m+xml" t793bisbre Politik">Gambisbre Politikrna>">/793bie-inem-2Islami0yti AktionsfrontlrIslami0yti Aktionsfrontref="http://de.wikiactu.com724y>+xml" tFu938ball-Bundesliga dt. allg.">Fußball-Bun938be-inem-2Islami0yti Armee im IraklrIslami0yti Armee im Irakhref="http://de.wikiactu.com2473"m+xml" t613a (Stadt)">Gaza (Stadt)rna>">/" e<' />> 613a e-inem-2Islami0yti Dsinihad-UnionlrIslami0yti Dsinihad-Unionhref="http://de.wikiactu.com5350y>+xml" t322ball allg.">Fußball allg.rna>">/" e<' /3224 e-inem-2Islami0ytir DsinihadlrIslami0ytir Dsinihadhref="http://de.wikiactu.com1214y>+xml" tG0re Roger">Frère Rogerrna>">/" e<' />> 1097ee-inem-2Islami0musneIslami0mushref="http://de.wikiactu.com2473"m+xml" t783a (Stadt)">Gaza (Stadt)rna>">/" e<' />> 783a e-inem-2Isländi0yti Außenpolitik-1Isländi0yti Außenpolitikhref="http://de.wikiactu.com1214y>+xml" t837eries Lafayette"tGaleries Lafayetterna>"837ere-inem-2Isländi0yti Personalie-4Isländi0yti Personaliehref="http://de.wikiactu.com5350y>+xml" t33eries Lafayette"tGaleries Lafayetterna>"33aere-inem-2Ismail Haniye lrIsmail Haniye ref="http://de.wikiactu.com741"m+xml" tGa84rbisbre Politik">Gambisbre Politikrna>">/84rre-inem-2Ismaniegm Ismanieghref="http://de.wikiactu.com2473"m+xml" t785dez">Gardezrna>">/" e<' />>
Futtermittelherstel34ttee-inem-2Israel-Preism Israel-Preishref="http://de.wikiactu.com2473"m+xml" tG7eries Lafayette"tGaleries Lafayetterna>"G7ere-inem-2Israeli0yti Außenpolitik-1Israeli0yti Außenpolitikhref="http://de.wikiactu.com1214y>+xml" t582apagosinseln">Galapagosinselnrna>">/" e<582ape-inem-2Israeli0yti Personalie-4Israeli0yti Personaliehref="http://de.wikiactu.com2473"m+xml" tG88re Roger">Frère Rogerrna>">/" e<' />> 288rv clre-iIsraeli0ytis Militärwesa m Israeli0ytis Militärwesa href="http://de.wikiactu.com2473"m+xml" t636iburg im Üechtland">Freiburg im Üechtl636ibv clre-iIsraeliti0yti Kultusgemeinde (Wia )m Israeliti0yti Kultusgemeinde (Wia )ref="http://de.wikiactu.com741"m+xml" tGa31al Mubarak">Gamal Mubarakrna>">/" e<' />31alv clre-iISRO>"ISROhref="http://de.wikiactu.com1214y>+xml" tG0xy 15"tGalaxy 15rna>">/" e<' />>
>ISS-4ISShref="http://de.wikiactu.com4871ym+xml" t93rtwangenytFurtwangenrna>">/" e<' />> Gambisbre Politikrna>">/76re-inem-2Istanbulm Istanbulhref="http://de.wikiactu.com3655"m+xml" t74termittelhersteller">Futtermittelherstel74tee-inem-2Istvan GyulaineIstvan Gyulaihref="http://de.wikiactu.com2473"m+xml" tG83ball-2.Bundesliga dt. (Spielbericht)ytFG83be-inem-2IT-BranytineIT-Branytihref="http://de.wikiactu.com2473"m+xml" t7z1ball allg.">Fußball allg.rna>">/" e<' /7z1bae-inem-2IT-News-PortalneIT-News-Portalhref="http://de.wikiactu.com4871ym+xml" tG7bdez">Gardezrna>">/" e<' />>
"Italia dei Valoriref="http://de.wikiactu.com741"m+xml" tGa802ball allg.">Fußball allg.rna>">/" e<' /802bae-inem-2Italieni0yti Außenpolitik-1Italieni0yti Außenpolitikhref="http://de.wikiactu.com4871ym+xml" tG12ileo Galilei">Galileo Galileirna>">/" eFuttermittelherstel14ttee-inem-2Italieni0yti Gar3e-isbarkemt lItalieni0yti Gar3e-isbarkemthref="http://de.wikiactu.com4871ym+xml" tG31ball allg.">Fußball allg.rna>">/" e<' /G31bae-inem-2Italieni0yti Luftwaffe lItalieni0yti Luftwaffehref="http://de.wikiactu.com4871ym+xml" tG95ball-1.Liga SlowakeiytFußball-1.Liga SG95be-inem-2Italieni0yti Personalie-4Italieni0yti Personaliehref="http://de.wikiactu.com2473"m+xml" tG88ball-2.Bundesliga dt. (Spielbericht)ytFG88ile-inem-2Italieni0ytis Militärwesa m Italieni0ytis Militärwesa ref="http://de.wikiactu.com741"m+xml" tGa31al Mubarak">Gamal Mubarakrna>">/" e<' />31ale-inem-2Italy First lItaly Firstref="http://de.wikiactu.com741"m+xml" tGa827ball-Bundesliga dt. allg.">Fußball-Bun827be-inem-2Ithaca lIthacaref="http://de.wikiactu.com741"m+xml" tGa85un Politik">Gabun Politikrna>">/" e<' />85une-inem-2ITT Industriesm ITT Industriesref="http://de.wikiactu.com741"m+xml" tGa31rballtrainer">Fußballtrainerrna>">/" e<31rbiv clre-iITunis Store-4ITunis Storehref="http://de.wikiactu.com2473"m+xml" tG59a (Stadt)">Gaza (Stadt)rna>">/" e<' />> 259a e-inem-2Itzehoe-4Itzehoeref="http://de.wikiactu.com741"m+xml" tGa890all allg.">Fußball allg.rna>">/" e<' /890ae-inem-2Ivan Biacom Ivan Biacohref="http://de.wikiactu.com1214y>+xml" t599a (Stadt)">Gaza (Stadt)rna>">/" e<' />> 599a e-inem-2Ivo Josipovićm Ivo Josipovićhref="http://de.wikiactu.com4871ym+xml" tG48ball-2.Bundesliga dt. (Spielbericht)ytFG48be-inem-2IW-1IWref="http://de.wikiactu.com724y>+xml" tFu152ball allg.">Fußball allg.rna>">/" e<' /152bae-inem-2IWC-4IWCref="http://de.wikiactu.com741"m+xml" tGa16re Roger">Frère Rogerrna>">/" e<' />> 1697ee-inem-2IWF-3IWFref="http://de.wikiactu.com741"m+xml" tGa112ileo Galilei">Galileo Galileirna>">/" e<112ile-inem-2Iyad Allawi>"Iyad Allawihref="http://de.wikiactu.com4871ym+xml" tG8ßball-2.Bundesliga dt. (Spielbericht)ytFG8ßbe-inem-2IZA-4IZAhref="http://de.wikiactu.com2473"m+xml" t402al Mubarak">Gamal Mubarakrna>">/" e<' />402ale-inem-2İzmmt lİzmmthref="http://de.wikiactu.com1214y>+xml" tG3leries Lafayette"tGaleries Lafayetterna>"G3ler<' />> Garbring b.Münbrenrna36bbrv clre-iJaap de Hoop Sineff4rm Jaap de Hoop Sineff4rref="http://de.wikiactu.com741"m+xml" tGa38ra (Stadt)">Gaza (Stadt)rna>">/" e<' />> 38ra v clre-iJablokom Jablokohref="http://de.wikiactu.com5350y>+xml" t392bisbre Politik">Gambisbre Politikrna>">/392bi e<' />>JACDEC-4JACDEChref="http://de.wikiactu.com4871ym+xml" t677termittelhersteller">Futtermittelherstel6770 v clre-iJacek C3e-ockineJacek C3e-ockihref="http://de.wikiactu.com2473"m+xml" tG03ball-2.Bundesliga dt. (Spielbericht)ytFG03be-inem-2Jack StrawneJack Strawref="http://de.wikiactu.com724y>+xml" tFu158ball-2.Bundesliga dt. (Spielbericht)ytF158be-inem-2Jack Welm lrJack Welm href="http://de.wikiactu.com1214y>+xml" t59ra (Stadt)">Gaza (Stadt)rna>">/" e<' />> 59ra e-inem-2Jack Wolfskin-4Jack Wolfskinref="http://de.wikiactu.com741"m+xml" tGa11termittelhersteller">Futtermittelherstel110 v clre-iJackson (Mississippi)-4Jackson (Mississippi)href="http://de.wikiactu.com4871ym+xml" t64un Politik">Gabun Politikrna>">/" e<' />64une-inem-2Jackson Hole-4Jackson Holehref="http://de.wikiactu.com4871ym+xml" t932bisbre Politik">Gambisbre Politikrna>">/932bie-inem-2Jacksonville-4Jacksonvillehref="http://de.wikiactu.com3655"m+xml" t92ank-Jürgen Weise">Frank-Jürgen Weiserna9210 v clre-iJacob Mafume-4Jacob Mafumehref="http://de.wikiactu.com4871ym+xml" tG4dez">Gardezrna>">/" e<' />>
"43aere-inem-2Jacquis Edou"><5Alexism Jacquis Edou"><5Alexishref="http://de.wikiactu.com2473"m+xml" tG08eries Lafayette"tGaleries Lafayetterna>"208ere-inem-2Jacquis Roggem Jacquis Roggehref="http://de.wikiactu.com2473"m+xml" tG50xy 15"tGalaxy 15rna>">/" e<' />>
"518ere-inem-2Jacquis Titsm Jacquis Titshref="http://de.wikiactu.com2473"m+xml" t40ßball in KroatienytFußball in Kroatienr40ßbe-inem-2Jacquis Villeneuvem Jacquis Villeneuvehref="http://de.wikiactu.com3655"m+xml" t92al Mubarak">Gamal Mubarakrna>">/" e<' />92ale-inem-2Jadranka Kosorm Jadranka Kosorhref="http://de.wikiactu.com5350y>+xml" t3n8edrich II. (Preußen)ytFriedrich II. (Pr3n8ede-inem-2Jaén-4Jaénref="http://de.wikiactu.com741"m+xml" tGa182ball allg.">Fußball allg.rna>">/" e<' /182bav clre-iJagd-4Jagdhref="http://de.wikiactu.com3655"m+xml" t777ball-Bundesliga dt. allg.">Fußball-Bun777b e<' />>Jaipurm Jaipurref="http://de.wikiactu.com741"m+xml" tGa167eries Lafayette"tGaleries Lafayetterna>"167er e<' />>Jakarta-1Jakartahref="http://de.wikiactu.com1214y>+xml" t595dez">Gardezrna>">/" e<' />>
>Jakob Maria Mierre-eid-4Jakob Maria Mierre-eidhref="http://de.wikiactu.com3655"m+xml" t7702pagosinseln">Galapagosinselnrna>">/" e<7702p e<' />>Jakutsk-1Jakutskhref="http://de.wikiactu.com5350y>+xml" t35rball-Weltmeivtersbraft der Frauen 2011y3572p e<' />>Jameln-4Jamelnhref="http://de.wikiactu.com1214y>+xml" t87rball allg.">Fußball allg.rna>">/" e<' /8744p e<' />>James David Wolfensohn-4James David Wolfensohnhref="http://de.wikiactu.com5350y>+xml" t2660n Politik">Gabun Politikrna>">/" e<' />2660n e<' />>James Doohan-4James Doohanref="http://de.wikiactu.com741"m+xml" tGa892bisbre Politik">Gambisbre Politikrna>">/892bi e<' />>James van Allen-4James van Allenref="http://de.wikiactu.com741"m+xml" tGa856ball allg.">Fußball allg.rna>">/" e<' /856ba e<' />>Jamestown-4Jamestownhref="http://de.wikiactu.com5350y>+xml" t3zballtrainer">Fußballtrainerrna>">/" e<3zim<' />> Gambisbre Politikrna>">/88bi<' />> Fußball-Bun732be-inem-2Jammum Jammuref="http://de.wikiactu.com741"m+xml" tGa53bisbre Politik">Gambisbre Politikrna>">/53bie-inem-2Jammu und Kashmir (Bundesstaat)m Jammu und Kashmir (Bundesstaat)href="http://de.wikiactu.com4871ym+xml" t6584l Mubarak">Gamal Mubarakrna>">/" e<' />6584le-inem-2Jamrud-4Jamrudhref="http://de.wikiactu.com3655"m+xml" t969ileo Galilei">Galileo Galileirna>">/" e<969ile-inem-2Jan Dittrim lrJan Dittrim href="http://de.wikiactu.com3655"m+xml" t961imağuva">Gazimağuvarna>">/" e<' />> ">/" e<' />>
Fußball allg.rna>">/" e<' /292bav clre-iJan Pet4r BalkenendeneJan Pet4r Balkenendehref="http://de.wikiactu.com5350y>+xml" t242apagosinseln">Galapagosinselnrna>">/" e<242apv clre-iJan Ullrim lrJan Ullrim href="http://de.wikiactu.com5350y>+xml" t265un Politik">Gabun Politikrna>">/" e<' />265unv clre-iJane RusselllrJane Russellhref="http://de.wikiactu.com2473"m+xml" t78zballtrainer">Fußballtrainerrna>">/" e<78zbv clre-iJanet JacksonlrJanet Jacksonref="http://de.wikiactu.com741"m+xml" tGa194edrich II. (Preußen)ytFriedrich II. (Pr194ede-inem-2Janez JansalrJanez Jansaref="http://de.wikiactu.com741"m+xml" tGa534dez">Gardezrna>">/" e<' />>
Fußball allg.rna>">/" e<' /395bav clre-iJapan Airlinesm Japan Airlineshref="http://de.wikiactu.com2473"m+xml" t787ball-Bundesliga dt. allg.">Fußball-Bun787b e<' />>Japani0yti Gar3e-isbarkemt lJapani0yti Gar3e-isbarkemtref="http://de.wikiactu.com741"m+xml" tGal392pagosinseln">Galapagosinselnrna>">/" e<7392p e<' />>Japani0yti Kultur lJapani0yti Kulturref="http://de.wikiactu.com741"m+xml" tGa38ttermittelhersteller">Futtermittelherstel38ebv clre-iJapani0yti Personalie-4Japani0yti Personaliehref="http://de.wikiactu.com2473"m+xml" t788al Mubarak">Gamal Mubarakrna>">/" e<' />788alv clre-iJapani0ytis Postu>ternehma m Japani0ytis Postu>ternehma href="http://de.wikiactu.com5350y>+xml" t3n0xy 15"tGalaxy 15rna>">/" e<' />>
Galileo Galileirna>">/" e<737ilv clre-iJaroslawllrJaroslawlhref="http://de.wikiactu.com1214y>+xml" tG36ball allg.">Fußball allg.rna>">/" e<' /G36bav clre-iJarosław KaczyńskineJarosław Kaczyńskiref="http://de.wikiactu.com724y>+xml" tFu953imağuva">Gazimağuvarna>">/" e<' />> Fußball-Bun157bv clre-iJasnym Jasnyhref="http://de.wikiactu.com1214y>+xml" t51ßball-2.Bundesliga dt. (Spielbericht)ytF51ßbv clre-iJason 2m Jason 2ref="http://de.wikiactu.com741"m+xml" tGa57termittelhersteller">Futtermittelherstel570 v clre-iJassir Arafat lJassir Arafatref="http://de.wikiactu.com741"m+xml" tGa88xball-2.Bundesliga dt. (Spielbericht)ytF88xb e<' />>JAT Airwaysm JAT Airwayshref="http://de.wikiactu.com2473"m+xml" t45ra (Stadt)">Gaza (Stadt)rna>">/" e<' />> 45ra v clre-iJavier SolanalrJavier Solanahref="http://de.wikiactu.com4871ym+xml" t643ball-2.Bundesliga dt. (Spielbericht)ytF643bv clre-iJawa Barat lJawa Barathref="http://de.wikiactu.com5350y>+xml" t371a (Stadt)">Gaza (Stadt)rna>">/" e<' />> 371a e<' />>JAXAm JAXAhref="http://de.wikiactu.com2473"m+xml" t97xball-2.Bundesliga dt. (Spielbericht)ytF97xbv clre-iJay-Z lJay-Zref="http://de.wikiactu.com741"m+xml" tGa528ball-Bundesliga dt. allg.">Fußball-Bun528a v clre-iJayapuralrJayapurahref="http://de.wikiactu.com4871ym+xml" t66dez">Gardezrna>">/" e<' />>
Fußball-Bun7ra v clre-iJCSat ank-JCSat anhref="http://de.wikiactu.com2473"m+xml" tG77termittelhersteller">Futtermittelherstel2770 v clre-iJean AlesineJean Alesihref="http://de.wikiactu.com5350y>+xml" t2650n Politik">Gabun Politikrna>">/" e<' />2650 v clre-iJean Harlow-4Jean Harlowref="http://de.wikiactu.com741"m+xml" tGa31ba (Stadt)">Gaza (Stadt)rna>">/" e<' />> 315bv clre-iJean M3e-el Jarre-4Jean M3e-el Jarreref="http://de.wikiactu.com741"m+xml" tGa3860n Politik">Gabun Politikrna>">/" e<' />3860nv clre-iJean Todt>"Jean Todthref="http://de.wikiactu.com4871ym+xml" t601un Politik">Gabun Politikrna>">/" e<' />601unv clre-iJean-Bertrand Aristide-4Jean-Bertrand Aristideref="http://de.wikiactu.com741"m+xml" tGal34ileo Galilei">Galileo Galileirna>">/" eGalileo Galileirna>">/" eGabun Politikrna>">/" e<' />740unv clre-iJean-François Copé-4Jean-François Copéhref="http://de.wikiactu.com4871ym+xml" t62bisbre Politik">Gambisbre Politikrna>">/62biv clre-iJean-Jacquis Dordain-4Jean-Jacquis Dordainhref="http://de.wikiactu.com5350y>+xml" t32ra (Stadt)">Gaza (Stadt)rna>">/" e<' />> 324bv clre-iJean-Louis Borloo-4Jean-Louis Borloohref="http://de.wikiactu.com4871ym+xml" t643iburg im Üechtland">Freiburg im Üechtl643ibv clre-iJean-Luc Mélenchon-4Jean-Luc Mélenchonhref="http://de.wikiactu.com2473"m+xml" t94Aeries Lafayette"tGaleries Lafayetterna>"94Aere-inem-2Jean-Marc de La Sablière-4Jean-Marc de La Sablièrehref="http://de.wikiactu.com3655"m+xml" t740al Mubarak">Gamal Mubarakrna>">/" e<' />74ale-inem-2Jean-Marie Li Pen-4Jean-Marie Li Penhref="http://de.wikiactu.com4871ym+xml" t64dez">Gardezrna>">/" e<' />>
Gaza (Stadt)rna>">/" e<' />> 404bv clre-iJean-Pierre Raffarin-4Jean-Pierre Raffarinhref="http://de.wikiactu.com2473"m+xml" t942al Mubarak">Gamal Mubarakrna>">/" e<' />942alv clre-iJeb Bus lrJeb Bus ref="http://de.wikiactu.com741"m+xml" tGa822al Mubarak">Gamal Mubarakrna>">/" e<' />822alv clre-iJef Raskin-4Jef Raskinref="http://de.wikiactu.com741"m+xml" tGa165dez">Gardezrna>">/" e<' />>
">/" e<' />>
Gambisbre Politikrna>">/G77biv clre-iJelabuga-4Jelabugahref="http://de.wikiactu.com2473"m+xml" tG01ball allg.">Fußball allg.rna>">/" e<' /G01bav clre-iJelena Hoffman -4Jelena Hoffman ref="http://de.wikiactu.com741"m+xml" tGa170ball allg.">Fußball allg.rna>">/" e<' /G70bav clre-iJemaah Islamiya lrJemaah Islamiya href="http://de.wikiactu.com3655"m+xml" t791al Mubarak">Gamal Mubarakrna>">/" e<' />791alv clre-iJemeniti0ytis Militärwesa m Jemeniti0ytis Militärwesa ref="http://de.wikiactu.com741"m+xml" tGa160all allg.">Fußball allg.rna>">/" e<' /160av clre-iJenalrJenahref="http://de.wikiactu.com4871ym+xml" t49un Politik">Gabun Politikrna>">/" e<' />49unv clre-iJenbam lrJenbam ref="http://de.wikiactu.com741"m+xml" tGa183imağuva">Gazimağuvarna>">/" e<' />> Galapagosinselnrna>">/" e<8102pv clre-iJens Goebelm Jens Goebelhref="http://de.wikiactu.com2473"m+xml" tG32ball allg.">Fußball allg.rna>">/" e<' /232ba e<' />>Jens Lehman -4Jens Lehman href="http://de.wikiactu.com3655"m+xml" t79miburg im Üechtland">Freiburg im Üechtl79mib e<' />>Jens Nowotnym Jens Nowotnyhref="http://de.wikiactu.com5350y>+xml" t29dez">Gardezrna>">/" e<' />>
>Jenson Butto -4Jenson Butto href="http://de.wikiactu.com3655"m+xml" t79mal Mubarak">Gamal Mubarakrna>">/" e<' />792alv clre-iJer3e-o-4Jer3e-ohref="http://de.wikiactu.com3655"m+xml" t79ttermittelhersteller">Futtermittelherstell9ebv clre-iJeroen van der Veer-4Jeroen van der Veerhref="http://de.wikiactu.com4871ym+xml" t60termittelhersteller">Futtermittelherstel60tev clre-iJerome David Salinger-4Jerome David Salingerhref="http://de.wikiactu.com2473"m+xml" t978re Roger">Frère Rogerrna>">/" e<' />> 978rv clre-iJerry Yaegm Jerry Yaeghref="http://de.wikiactu.com3655"m+xml" t75dez">Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />99ba e<' />>Jerzy Montagm Jerzy Montagref="http://de.wikiactu.com724y>+xml" tFu9520ytG-20rna>">/" e<' />>
>Jesse JacksonlrJesse Jacksonref="http://de.wikiactu.com741"m+xml" tGa860ball allg.">Fußball allg.rna>">/" e<' /860ba e<' />>Jessica SinwarzlrJessica Sinwarzhref="http://de.wikiactu.com5350y>+xml" t3zzbisbre Politik">Gambisbre Politikrna>">/3zzbi e<' />>Jessica Walter-4Jessica Walterhref="http://de.wikiactu.com4871ym+xml" tG40ball allg.">Fußball allg.rna>">/" e<' /G40ba e<' />>Jet Blue Airwaysm Jet Blue Airwayshref="http://de.wikiactu.com4871ym+xml" t613al Mubarak">Gamal Mubarakrna>">/" e<' />613ale-inem-2Jet Propulsine Laboratorym Jet Propulsine Laboratoryref="http://de.wikiactu.com724y>+xml" tFu953re Roger">Frère Rogerrna>">/" e<' />> 953bi e<' />>JettingenlrJettingenhref="http://de.wikiactu.com2473"m+xml" tG58re Roger">Frère Rogerrna>">/" e<' />> 258bi e<' />>Jettingen-Sineppam lrJettingen-Sineppam href="http://de.wikiactu.com2473"m+xml" t4560n Politik">Gabun Politikrna>">/" e<' />4560n e<' />>Jigme Ktisar Namgyel Wangchuck-1Jigme Ktisar Namgyel Wangchuckhref="http://de.wikiactu.com2473"m+xml" t456un Politik">Gabun Politikrna>">/" e<' />456un e<' />>Jigme Singye Wangchuck-1Jigme Singye Wangchuckhref="http://de.wikiactu.com5350y>+xml" t26termittelhersteller">Futtermittelherstel26te e<' />>Jimmy Carter-4Jimmy Carterhref="http://de.wikiactu.com5350y>+xml" t344al Mubarak">Gamal Mubarakrna>">/" e<' />344al e<' />>Jimmy Walesm Jimmy Waleshref="http://de.wikiactu.com4871ym+xml" t690all allg.">Fußball allg.rna>">/" e<' /690ae-inem-2Jinan-4Jinanhref="http://de.wikiactu.com3655"m+xml" t723bisbre Politik">Gambisbre Politikrna>">/723bi e<' />>Jinxi-4Jinxiref="http://de.wikiactu.com724y>+xml" tFu94ba (Stadt)">Gaza (Stadt)rna>">/" e<' />> 94ba e<' />>Jiri Paroubek-1Jiri Paroubekref="http://de.wikiactu.com741"m+xml" tGa80un Politik">Gabun Politikrna>">/" e<' />80unv clre-iJiuquan-4Jiuquanhref="http://de.wikiactu.com4871ym+xml" t6294l Mubarak">Gamal Mubarakrna>">/" e<' />629ba e<' />>Joam im Gauck-1Joam im Gauckref="http://de.wikiactu.com741"m+xml" tGa557ball-Bundesliga dt. allg.">Fußball-Bun557bv clre-iJoam im Herrman -4Joam im Herrman href="http://de.wikiactu.com4871ym+xml" t63rtwangenytFurtwangenrna>">/" e<' />> Freiburg im ÜechtlG73ibv clre-iJoam im Löw-4Joam im Löwref="http://de.wikiactu.com741"m+xml" tGa160ball-Bundesliga dt. allg.">Fußball-Bun160bv clre-iJoam im Wanke-4Joam im Wankeref="http://de.wikiactu.com741"m+xml" tGa106dez">Gardezrna>">/" e<' />>
Gardezrna>">/" e<' />>
Fußball allg.rna>">/" e<' /375ba e<' />>Joaquim Chissanom Joaquim Chissanoref="http://de.wikiactu.com741"m+xml" tGa888un Politik">Gabun Politikrna>">/" e<' />888un e<' />>Joaquie Lavinm Joaquie Lavinhref="http://de.wikiactu.com2473"m+xml" t408edrich II. (Preußen)ytFriedrich II. (Pr4n8ede-inem-2Joaquín Navarro-Vallsm Joaquín Navarro-Vallsref="http://de.wikiactu.com741"m+xml" tGa80rchalngFunchalrna>">/" e<' />>
Galileo Galileirna>">/" e<609ile-inem-2Joe-en FikibarthneJoe-en Fikibarthref="http://de.wikiactu.com741"m+xml" tGa8202pagosinseln">Galapagosinselnrna>">/" e<8202pv clre-iJoe-en Litterst lJoe-en Littersthref="http://de.wikiactu.com1214y>+xml" t87xball-2.Bundesliga dt. (Spielbericht)ytF871ilv clre-iJoe-en Partsm lrJoe-en Partsm href="http://de.wikiactu.com3655"m+xml" t707termittelhersteller">Futtermittelherstel707tev clre-iJoe Frazier-4Joe Frazierref="http://de.wikiactu.com741"m+xml" tGa812ball-Europameivtersbraft 2008ytFußball812be-inem-2Johan Friso vne Oranien-Niacaum Johan Friso vne Oranien-Niacauhref="http://de.wikiactu.com2473"m+xml" tG15un Politik">Gabun Politikrna>">/" e<' />215unv clre-iJohan Micoud-4Johan Micoudhref="http://de.wikiactu.com4871ym+xml" t6871y 15"tGalaxy 15rna>">/" e<' />>
">/" e<' />> Gambisbre Politikrna>">/92rbie-inem-2Jóhanna Sigurðardóttir-4Jóhanna Sigurðardóttirhref="http://de.wikiactu.com4871ym+xml" tG72ileo Galilei">Galileo Galileirna>">/" eFußball-Bun920be-inem-2Johannes Feldmayer-4Johannes Feldmayerhref="http://de.wikiactu.com2473"m+xml" tG51a (Stadt)">Gaza (Stadt)rna>">/" e<' />> G51a e-inem-2Johannes Heesters-4Johannes Heestershref="http://de.wikiactu.com3655"m+xml" t793un Politik">Gabun Politikrna>">/" e<' />793unv clre-iJohannes Kahrs-4Johannes Kahrsref="http://de.wikiactu.com741"m+xml" tGa561un Politik">Gabun Politikrna>">/" e<' />561unv clre-iJohannes Mario Simmelm Johannes Mario Simmelref="http://de.wikiactu.com724y>+xml" tFu15xy 15"tGalaxy 15rna>">/" e<' />>
Gardezrna>">/" e<' />>
Fußballtrainerrna>">/" e<796twv clre-iJohanniskreuz-4Johanniskreuzhref="http://de.wikiactu.com2473"m+xml" t781al Mubarak">Gamal Mubarakrna>">/" e<' />781alv clre-iJohn Abizaid-4John Abizaidref="http://de.wikiactu.com741"m+xml" tGal37termittelhersteller">Futtermittelherstel737tev clre-iJohn Birrym John Birryref="http://de.wikiactu.com741"m+xml" tGa57eries Lafayette"tGaleries Lafayetterna>"57ere-inem-2John Demjanjukm John Demjanjukhref="http://de.wikiactu.com4871ym+xml" t49al Mubarak">Gamal Mubarakrna>">/" e<' />499alv clre-iJohn Edwardsm John Edwardshref="http://de.wikiactu.com3655"m+xml" t91rhalngFunchalrna>">/" e<' />>
Fußball-Bun7865lv clre-iJohn F. Kennedy International Airportm John F. Kennedy International Airporthref="http://de.wikiactu.com1214y>+xml" t518ball-Bundesliga dt. allg.">Fußball-Bun5185lv clre-iJohn G. ThompsonlrJohn G. Thompsonhref="http://de.wikiactu.com2473"m+xml" t767ball-Bundesliga dt. allg.">Fußball-Bun7675lv clre-iJohn Garaegm John Garaegref="http://de.wikiactu.com741"m+xml" tGa383ball allg.">Fußball allg.rna>">/" e<' /383bav clre-iJohn Gudenusm John Gudenusref="http://de.wikiactu.com741"m+xml" tGa101rhalngFunchalrna>">/" e<' />>
Futtermittelherstel757tev clre-iJohn Kerrym John Kerryref="http://de.wikiactu.com741"m+xml" tGa335al Mubarak">Gamal Mubarakrna>">/" e<' />335alv clre-iJohn LennonlrJohn Lennonhref="http://de.wikiactu.com4871ym+xml" t6771y 15"tGalaxy 15rna>">/" e<' />>
Gaza (Stadt)rna>">/" e<' />> 293a v clre-iJohn Lynch Phillipsm John Lynch Phillipshref="http://de.wikiactu.com2473"m+xml" tG26ball allg.">Fußball allg.rna>">/" e<' /226bav clre-iJohn McCain-4John McCainhref="http://de.wikiactu.com2473"m+xml" tG11un Politik">Gabun Politikrna>">/" e<' />G11unv clre-iJohn Negroponte-4John Negropontehref="http://de.wikiactu.com2473"m+xml" t902bisbre Politik">Gambisbre Politikrna>">/902rhv clre-iJohn O'Donoghue-4John O'Donoghuehref="http://de.wikiactu.com2473"m+xml" tG0bbring b.Münbren">Garbring b.MünbrenrnaG0bbrv clre-iJohn R. BoltonlrJohn R. Boltonhref="http://de.wikiactu.com4871ym+xml" t484ileo Galilei">Galileo Galileirna>">/" e<484ilv clre-iJohn Reid-4John Reidhref="http://de.wikiactu.com3655"m+xml" t204un Politik">Gabun Politikrna>">/" e<' />G04unv clre-iJohn Robertsm John Robertsref="http://de.wikiactu.com741"m+xml" tGa865xy 15"tGalaxy 15rna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />765alv clre-iJohn ShannonlrJohn Shannonref="http://de.wikiactu.com741"m+xml" tGa867termittelhersteller">Futtermittelherstel867tev clre-iJohn T. Tate-4John T. Tateref="http://de.wikiactu.com741"m+xml" tGa89re Roger">Frère Rogerrna>">/" e<' />> 89rv clre-iJohn Towers-4John Towersref="http://de.wikiactu.com741"m+xml" tGa18mal Mubarak">Gamal Mubarakrna>">/" e<' />18malv clre-iJohn W. Snow-4John W. Snowhref="http://de.wikiactu.com4871ym+xml" t64al Mubarak">Gamal Mubarakrna>">/" e<' />649alv clre-iJohn WaltonlrJohn Waltonhref="http://de.wikiactu.com4871ym+xml" t663iburg im Üechtland">Freiburg im Üechtl663brv clre-iJohnny DepplrJohnny Depphref="http://de.wikiactu.com5350y>+xml" t26miburg im Üechtland">Freiburg im Üechtl26mibv clre-iJohnson Space Center-4Johnson Space Centerref="http://de.wikiactu.com741"m+xml" tGa171imağuva">Gazimağuvarna>">/" e<' />> Gamal Mubarakrna>">/" e<' />922alv clre-iJonatan JohanssonlrJonatan Johanssonhref="http://de.wikiactu.com3655"m+xml" t962al Mubarak">Gamal Mubarakrna>">/" e<' />962alv clre-iJoplin (Missouri)-4Joplin (Missouri)href="http://de.wikiactu.com4871ym+xml" t68zballtrainer">Fußballtrainerrna>">/" e<68zbv clre-iJörg Armbruster-4Jörg Armbrusterhref="http://de.wikiactu.com1214y>+xml" t87xeries Lafayette"tGaleries Lafayetterna>"87xerv clre-iJörg Dillman -4Jörg Dillman href="http://de.wikiactu.com5350y>+xml" t289a (Stadt)">Gaza (Stadt)rna>">/" e<' />> 289a e-inem-2Jörg Haider-4Jörg Haiderhref="http://de.wikiactu.com3655"m+xml" t9imağuva">Gazimağuvarna>">/" e<' />> Gabun Politikrna>">/" e<' />70unv clre-iJörg Maurer-4Jörg Maurerhref="http://de.wikiactu.com2473"m+xml" tG73ball-2.Bundesliga dt. (Spielbericht)ytFG73bv clre-iJörg Tauss-4Jörg Taussref="http://de.wikiactu.com741"m+xml" tGa12bisbre Politik">Gambisbre Politikrna>">/12biv clre-iJörg Woltman -4Jörg Woltman ref="http://de.wikiactu.com741"m+xml" tGa11ra (Stadt)">Gaza (Stadt)rna>">/" e<' />> 11ra v clre-iJörg Ziercke-4Jörg Zierckeref="http://de.wikiactu.com741"m+xml" tGa380bisbre Politik">Gambisbre Politikrna>">/380biv clre-iJörg-Uwe Hah -4Jörg-Uwe Hah ref="http://de.wikiactu.com741"m+xml" tGa16al Mubarak">Gamal Mubarakrna>">/" e<' />16alv clre-iJorge Quiroga Ramírezm Jorge Quiroga Ramírezref="http://de.wikiactu.com741"m+xml" tGa13rball-Weltmeivtersbraft der Frauen 2011yG372p e<' />>Jorge Sampaiom Jorge Sampaiohref="http://de.wikiactu.com2473"m+xml" t41leries Lafayette"tGaleries Lafayetterna>"41ler e<' />>Jorge Valdanom Jorge Valdanohref="http://de.wikiactu.com4871ym+xml" t6571y 15"tGalaxy 15rna>">/" e<' />>
Fußball allg.rna>">/" e<' /l62ba e<' />>José Bonom José Bonoref="http://de.wikiactu.com741"m+xml" tGa56ball allg.">Fußball allg.rna>">/" e<' /56ba e<' />>José Luis Rodríguez Zapaterom José Luis Rodríguez Zapateroref="http://de.wikiactu.com741"m+xml" tGa13ral Mubarak">Gamal Mubarakrna>">/" e<' />1373yv clre-iJosé Manuel Durão Birrosom José Manuel Durão Birrosohref="http://de.wikiactu.com3655"m+xml" t794un Politik">Gabun Politikrna>">/" e<' />794unv clre-iJosé Miguel Insulzam José Miguel Insulzahref="http://de.wikiactu.com3655"m+xml" t96ball-Bundesliga dt. allg.">Fußball-Bun965lv clre-iJosé Mourinhom José Mourinhohref="http://de.wikiactu.com3655"m+xml" t9eries Lafayette"tGaleries Lafayetterna>"9ere-inem-2José Paolo Guerrerom José Paolo Guerrerohref="http://de.wikiactu.com3655"m+xml" t72ball-Bundesliga dt. allg.">Fußball-Bun725lv clre-iJosé Pekermanm José Pekermanref="http://de.wikiactu.com741"m+xml" tGa55al Mubarak">Gamal Mubarakrna>">/" e<' />553yv clre-iJosé Ramos-Horta-1José Ramos-Hortaref="http://de.wikiactu.com741"m+xml" tGa13rxy 15"tGalaxy 15rna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />41alv clre-iJosef Ackermannm Josef Ackermannref="http://de.wikiactu.com741"m+xml" tGa504imağuva">Gazimağuvarna>">/" e<' />> Gazimağuvarna>">/" e<' />> ">/" e<' />>
Gabun Politikrna>">/" e<' />79unv clre-iJosep BorrelllrJosep Borrellref="http://de.wikiactu.com741"m+xml" tGal3miburg im Üechtland">Freiburg im Üechtl73mibv clre-iJoseph Beuys-4Joseph Beuyshref="http://de.wikiactu.com3655"m+xml" t200ball-Bundesliga dt. allg.">Fußball-Bun20ßbe-inem-2Joseph Blatter-4Joseph Blatterhref="http://de.wikiactu.com3655"m+xml" t914dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />4330ne-inem-2Joseph Kabila-4Joseph Kabilaref="http://de.wikiactu.com724y>+xml" tFu156ball-2.Bundesliga dt. (Spielbericht)ytF1569ne-inem-2Joseph Ma Yinglin-4Joseph Ma Yinglinref="http://de.wikiactu.com724y>+xml" tFu156imağuva">Gazimağuvarna>">/" e<' />> Fußball-Bun211a e-inem-2Journalist lJournalisthref="http://de.wikiactu.com2473"m+xml" t788eries Lafayette"tGaleries Lafayetterna>"788ere-inem-2JR TokaineJR Tokaihref="http://de.wikiactu.com2473"m+xml" t788termittelhersteller">Futtermittelherstel78ebv clre-iJR West lJR Westhref="http://de.wikiactu.com2473"m+xml" t74al Mubarak">Gamal Mubarakrna>">/" e<' />74al e<' />>JSAT Corporation lJSAT Corporationhref="http://de.wikiactu.com4871ym+xml" tG42ileo Galilei">Galileo Galileirna>">/" eGamal Mubarakrna>">/" e<' />625alv clre-iJuan Antonio Samaranyt lJuan Antonio Samaranythref="http://de.wikiactu.com4871ym+xml" tG6ball allg.">Fußball allg.rna>">/" e<' /46ba e<' />>Juan Carlos I. (Spanien) lJuan Carlos I. (Spanien)href="http://de.wikiactu.com4871ym+xml" tG7termittelhersteller">FuttermittelherstelG7te e<' />>Juan Carlos Lópezm Juan Carlos Lópezhref="http://de.wikiactu.com2473"m+xml" t43ßball-2.Bundesliga dt. (Spielbericht)ytFG3ßbv clre-iJuan José Ibarretxem Juan José Ibarretxeref="http://de.wikiactu.com741"m+xml" tGa3002pagosinseln">Galapagosinselnrna>">/" e<3002pv clre-iJuan Pablo Montoyam Juan Pablo Montoyaref="http://de.wikiactu.com741"m+xml" tGa82rballtrainer">Fußballtrainerrna>">/" e<82rbv clre-iJuba-4Jubahref="http://de.wikiactu.com2473"m+xml" t19re Roger">Frère Rogerrna>">/" e<' />> 19rv clre-iJudentumm Judentumhref="http://de.wikiactu.com4871ym+xml" t658termittelhersteller">Futtermittelherstel658tev clre-iJudentum in Deutsm landm Judentum in Deutsm landhref="http://de.wikiactu.com5350y>+xml" t297ball-Bundesliga dt. allg.">Fußball-Bun297bv clre-iJudom Judohref="http://de.wikiactu.com4871ym+xml" t669ileo Galilei">Galileo Galileirna>">/" e<669ile-inem-2Jugendm Jugendhref="http://de.wikiactu.com1214y>+xml" t87leries Lafayette"tGaleries Lafayetterna>"87lere-inem-2Jugend forre-tm Jugend forre-thref="http://de.wikiactu.com5350y>+xml" t342bisbre Politik">Gambisbre Politikrna>">/342rhv clre-iJugendkriminalitätm Jugendkriminalitäthref="http://de.wikiactu.com3655"m+xml" t75termittelhersteller">Futtermittelherstel75te e<' />>Jugendmedienre-utz-Staatsvertragm Jugendmedienre-utz-Staatsvertraghref="http://de.wikiactu.com5350y>+xml" t3z7ball-Bundesliga dt. allg.">Fußball-Bun3675lv clre-iJugendorganisation lJugendorganisationref="http://de.wikiactu.com741"m+xml" tGa131ball allg.">Fußball allg.rna>">/" e<' /131bae-inem-2Jugendre-utz lJugendre-utzhref="http://de.wikiactu.com4871ym+xml" tG6rxy 15"tGalaxy 15rna>">/" e<' />>
Futtermittelherstel75de-inem-2Julis Verne (Raumre-iff) lJulis Verne (Raumre-iff)href="http://de.wikiactu.com5350y>+xml" t3120ytG-20rna>">/" e<' />>
Gaza (Stadt)rna>">/" e<' />> 813a e-inem-2Julia Gillard-4Julia Gillardhref="http://de.wikiactu.com4871ym+xml" t690al Mubarak">Gamal Mubarakrna>">/" e<' />69ale-inem-2Julia Lehner-4Julia Lehnerhref="http://de.wikiactu.com4871ym+xml" t6120ytG-20rna>">/" e<' />>
Frère Rogerrna>">/" e<' />> 918bi e<' />>Julián Herranz Casadom Julián Herranz Casadohref="http://de.wikiactu.com4871ym+xml" t6901y 15"tGalaxy 15rna>">/" e<' />>
Gardezrna>">/" e<' />>
>Julii Garberdiegm Julii Garberdiegref="http://de.wikiactu.com741"m+xml" tGa38al Mubarak">Gamal Mubarakrna>">/" e<' />38al e<' />>Julija Tymoschenkom Julija Tymoschenkohref="http://de.wikiactu.com2473"m+xml" tG29ileo Galilei">Galileo Galileirna>">/" eFrank-Jürgen Weiserna970nkv clre-iJULIS-1JULIShref="http://de.wikiactu.com2473"m+xml" tG5ba (Stadt)">Gaza (Stadt)rna>">/" e<' />> G5ba e<' />>Juneaum Juneauref="http://de.wikiactu.com741"m+xml" tGa893un Politik">Gabun Politikrna>">/" e<' />893unv clre-iJunge Nationaldemokraten lJunge Nationaldemokratenref="http://de.wikiactu.com741"m+xml" tGa532ball-Bundesliga dt. allg.">Fußball-Bun532be-inem-2Junge Presse Bayern lJunge Presse Bayernhref="http://de.wikiactu.com5350y>+xml" t3z9ileo Galilei">Galileo Galileirna>">/" e<369ile-inem-2Junge Union lJunge Unionhref="http://de.wikiactu.com2473"m+xml" t41un Politik">Gabun Politikrna>">/" e<' />419unv clre-iJunim irō Koizumi lJunim irō Koizumihref="http://de.wikiactu.com3655"m+xml" t757dez">Gardezrna>">/" e<' />>
>Junus Kanuni lJunus Kanunihref="http://de.wikiactu.com3655"m+xml" t79bbring b.Münbren">Garbring b.Münbrenrna79bbr e<' />>Jupp Heynckes-4Jupp Heynckeshref="http://de.wikiactu.com3655"m+xml" t9144l Mubarak">Gamal Mubarakrna>">/" e<' />9144p e<' />>JuralrJurahref="http://de.wikiactu.com4871ym+xml" t892apagosinseln">Galapagosinselnrna>">/" e<892ap e<' />>Jura-Zeitalter-4Jura-Zeitalterhref="http://de.wikiactu.com4871ym+xml" t68xball-2.Bundesliga dt. (Spielbericht)ytF68xb e<' />>Jürgen Banzer-4Jürgen Banzerref="http://de.wikiactu.com741"m+xml" tGa383ileo Galilei">Galileo Galileirna>">/" e<383b e<' />>Jürgen Chrobog-4Jürgen Chroboghref="http://de.wikiactu.com2473"m+xml" t904dez">Gardezrna>">/" e<' />>
">/" e<' />>
Gambisbre Politikrna>">/79biv clre-iJürgen Gelsdorf-4Jürgen Gelsdorfhref="http://de.wikiactu.com2473"m+xml" t748ball-2.Bundesliga dt. (Spielbericht)ytF748b e<' />>Jürgen Großman -4Jürgen Großman ref="http://de.wikiactu.com741"m+xml" tGa111un Politik">Gabun Politikrna>">/" e<' />111unv clre-iJürgen Hambree-tm Jürgen Hambree-tref="http://de.wikiactu.com741"m+xml" tGa123un Politik">Gabun Politikrna>">/" e<' />123unv clre-iJürgen Klinsman -4Jürgen Klinsman href="http://de.wikiactu.com4871ym+xml" t63rball-Weltmeivtersbraft der Frauen 2011y6372p e<' />>Jürgen Mae-o-4Jürgen Mae-oref="http://de.wikiactu.com741"m+xml" tGa577ileo Galilei">Galileo Galileirna>">/" e<577il e<' />>Jürgen Ma0ytir-4Jürgen Ma0ytirref="http://de.wikiactu.com741"m+xml" tGa32rball-Weltmeivtersbraft der Frauen 2011y3272p e<' />>Jürgen Ponto-4Jürgen Pontohref="http://de.wikiactu.com3655"m+xml" t208ball-2.Bundesliga dt. (Spielbericht)ytF208b e<' />>Jürgen Riegir-4Jürgen Riegirhref="http://de.wikiactu.com2473"m+xml" t42ball-Bundesliga dt. allg.">Fußball-Bun42be-inem-2Jürgen Rüttgers-4Jürgen Rüttgershref="http://de.wikiactu.com3655"m+xml" t92dez">Gardezrna>">/" e<' />>
Fußball-Bun237be-inem-2Jürgen ScardmpplrJürgen Scardmpphref="http://de.wikiactu.com2473"m+xml" tG70nk-Jürgen Weise">Frank-Jürgen Weiserna270nkv clre-iJürgen TrittinlrJürgen Trittinhref="http://de.wikiactu.com2473"m+xml" t762dez">Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />975al e<' />>Juri Kljutsm kowskineJuri Kljutsm kowskihref="http://de.wikiactu.com5350y>+xml" t26xeries Lafayette"tGaleries Lafayetterna>"26xer e<' />>Jurij Krawtschenkom Jurij Krawtschenkohref="http://de.wikiactu.com3655"m+xml" t234imağuva">Gazimağuvarna>">/" e<' />> Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />121ale-inem-2JusufijalrJusufijahref="http://de.wikiactu.com4871ym+xml" t698un Politik">Gabun Politikrna>">/" e<' />698une-inem-2Jyllands-Posten-4Jyllands-Postenref="http://de.wikiactu.com741"m+xml" tGa14zbisbre Politik">Gambisbre Politikrna>">/14zbie-inem-2K...!(Karat)">K…!(Karat)ref="http://de.wikiactu.com741"m+xml" tGal34ball-Bundesliga dt. allg.">Fußball-Bun73ra v clre-iKa-Sat lKa-Satref="http://de.wikiactu.com741"m+xml" tGa595xy 15"tGalaxy 15rna>">/" e<' />>
Futtermittelherstel185ev clre-iKabarett lKabaretthref="http://de.wikiactu.com5350y>+xml" t2802pagosinseln">Galapagosinselnrna>">/" e<2802pv clre-iKabarett allg. lKabarett allg.href="http://de.wikiactu.com2473"m+xml" tG53imağuva">Gazimağuvarna>">/" e<' />> Galileo Galileirna>">/" e<33b e<' />>Kabel 1 lKabel 1href="http://de.wikiactu.com2473"m+xml" t431al Mubarak">Gamal Mubarakrna>">/" e<' />431ale-inem-2Kabelfernsahen-4Kabelfernsahenref="http://de.wikiactu.com741"m+xml" tGa55ball-Bundesliga dt. allg.">Fußball-Bun55a v clre-iKabul-4Kabulref="http://de.wikiactu.com741"m+xml" tGa540al Mubarak">Gamal Mubarakrna>">/" e<' />54ale-inem-2Kadima-4Kadimahref="http://de.wikiactu.com3655"m+xml" t70ball-2.Bundesliga dt. (Spielbericht)ytF709ile-inem-2Kaffee-4Kaffeehref="http://de.wikiactu.com4871ym+xml" t8860n Politik">Gabun Politikrna>">/" e<' />8860nv clre-iKaguya-4Kaguyahref="http://de.wikiactu.com4871ym+xml" t678un Politik">Gabun Politikrna>">/" e<' />678xyv clre-iKahramanmaras-4Kahramanmarasref="http://de.wikiactu.com741"m+xml" tGa1792pagosinseln">Galapagosinselnrna>">/" e<1792pv clre-iKai Diekman -4Kai Diekman href="http://de.wikiactu.com4871ym+xml" tG4termittelhersteller">FuttermittelherstelG440nv clre-iKai-Uwe Ricke-4Kai-Uwe Rickeref="http://de.wikiactu.com741"m+xml" tGa170bisbre Politik">Gambisbre Politikrna>">/170biv clre-iKairom Kairohref="http://de.wikiactu.com2473"m+xml" t19al Mubarak">Gamal Mubarakrna>">/" e<' />19ale-inem-2Kaiserslautern lKaiserslauternhref="http://de.wikiactu.com3655"m+xml" t9ßball-2.Bundesliga dt. (Spielbericht)ytF93b e<' />>Kaká lKakáref="http://de.wikiactu.com741"m+xml" tGa5960n Politik">Gabun Politikrna>">/" e<' />5960n e<' />>Kalifornien lKalifornienhref="http://de.wikiactu.com4871ym+xml" tG7rballtrainer">Fußballtrainerrna>">/" e>Kaliningrad lKaliningradref="http://de.wikiactu.com741"m+xml" tGa32r0n Politik">Gabun Politikrna>">/" e<' />3270n e<' />>Kalkutta-4Kalkuttaref="http://de.wikiactu.com741"m+xml" tGa594dez">Gardezrna>">/" e<' />>
"86xer e<' />>Kalmar-4Kalmarref="http://de.wikiactu.com741"m+xml" tGa161imağuva">Gazimağuvarna>">/" e<' />> Gamal Mubarakrna>">/" e<' />79ral e<' />>Kalübbe-4Kalübbehref="http://de.wikiactu.com2473"m+xml" t331ball-1.Liga SlowakeiytFußball-1.Liga S331b e<' />>Kalvi-Preis-4Kalvi-Preishref="http://de.wikiactu.com4871ym+xml" t804dez">Gardezrna>">/" e<' />>
Gardezrna>">/" e<' />>
Fußball allg.rna>">/" e<' /G92bae-inem-2Kamala-4Kamalahref="http://de.wikiactu.com4871ym+xml" t83miburg im Üechtland">Freiburg im Üechtl83mibv clre-iKambodre-anisytis Militärwesa m Kambodre-anisytis Militärwesa href="http://de.wikiactu.com4871ym+xml" t8bbring b.Münbren">Garbring b.Münbrenrna85ibv clre-iKama m Kama href="http://de.wikiactu.com4871ym+xml" t8b10n Politik">Gabun Politikrna>">/" e<' />8b10nv clre-iKama zm Kama zhref="http://de.wikiactu.com4871ym+xml" tG48ball-Bundesliga dt. allg.">Fußball-BunG48bv clre-iKammergerie-tm Kammergerie-thref="http://de.wikiactu.com4871ym+xml" t80bbring b.Münbren">Garbring b.Münbrenrna805ibv clre-iKamp-Lintfortm Kamp-Lintforthref="http://de.wikiactu.com3655"m+xml" t973imağuva">Gazimağuvarna>">/" e<' />> Garbring b.Münbrenrna54bbrv clre-iKanadisyti Unterhauswahla m Kanadisyti Unterhauswahla href="http://de.wikiactu.com4871ym+xml" t863un Politik">Gabun Politikrna>">/" e<' />8631rv clre-iKanalm Kanalref="http://de.wikiactu.com741"m+xml" tGa92bbring b.Münbren">Garbring b.Münbrenrna92bbrv clre-iKanarisyti Insal m Kanarisyti Insal href="http://de.wikiactu.com5350y>+xml" t3z8ball allg.">Fußball allg.rna>">/" e<' /3z8bav clre-iKane-anaburi (Provinz) lKane-anaburi (Provinz)href="http://de.wikiactu.com2473"m+xml" t398ball allg.">Fußball allg.rna>">/" e<' /398bav clre-iKandern lKandernref="http://de.wikiactu.com741"m+xml" tGal34dez">Gardezrna>">/" e<' />>
Fußballtrainerrna>">/" e<26rbe-inem-2Kannibalismus-4Kannibalismusref="http://de.wikiactu.com741"m+xml" tGal720ytG-20rna>">/" e<' />>
Fußballtrainerrna>">/" e<842be-inem-2Kantathi Suphamongkhon-4Kantathi Suphamongkhonref="http://de.wikiactu.com741"m+xml" tGa530bisbre Politik">Gambisbre Politikrna>">/530bie-inem-2Kanusportm Kanusporthref="http://de.wikiactu.com2473"m+xml" t787ermittelhersteller">Futtermittelherstel787ee-inem-2Kaoru Yosanom Kaoru Yosanohref="http://de.wikiactu.com2473"m+xml" tG794l Mubarak">Gamal Mubarakrna>">/" e<' />G794le-inem-2Kap Hoorn lKap Hoornhref="http://de.wikiactu.com2473"m+xml" t354dez">Gardezrna>">/" e<' />>
">/" e<' />>
Futtermittelherstel7994le-inem-2KapMuGm KapMuGhref="http://de.wikiactu.com4871ym+xml" t68balltrainer">Fußballtrainerrna>">/" e<68be-inem-2Kapstadtm Kapstadthref="http://de.wikiactu.com3655"m+xml" t751rhalngFunchalrna>">/" e<' />>
Frère Rogerrna>">/" e<' />> 84bie-inem-2Karatschi-4Karatschihref="http://de.wikiactu.com3655"m+xml" t728ball allg.">Fußball allg.rna>">/" e<' /728bae-inem-2Karel De Gue-tm Karel De Gue-thref="http://de.wikiactu.com5350y>+xml" t310bisbre Politik">Gambisbre Politikrna>">/310bie-inem-2Karel Gottm Karel Gotthref="http://de.wikiactu.com4871ym+xml" tGb10n Politik">Gabun Politikrna>">/" e<' />4b10nv clre-iKaren (Volk)m Karen (Volk)href="http://de.wikiactu.com4871ym+xml" t86ball-2.Bundesliga dt. (Spielbericht)ytF869ile-inem-2Karen Webbm Karen Webbhref="http://de.wikiactu.com4871ym+xml" t662ileo Galilei">Galileo Galileirna>">/" e<662ile-inem-2Karibik-1Karibikref="http://de.wikiactu.com741"m+xml" tGa95un Politik">Gabun Politikrna>">/" e<' />95une-inem-2Karies-1Karieshref="http://de.wikiactu.com3655"m+xml" t75bbisbre Politik">Gambisbre Politikrna>">/755bie-inem-2Karin Gastinger-4Karin Gastingerref="http://de.wikiactu.com741"m+xml" tGa18ra (Stadt)">Gaza (Stadt)rna>">/" e<' />> 18ra v clre-iKarin Röpke-4Karin Röpkeref="http://de.wikiactu.com741"m+xml" tGa8144l Mubarak">Gamal Mubarakrna>">/" e<' />8144p e<' />>Karin Wolff-4Karin Wolffhref="http://de.wikiactu.com2473"m+xml" t433ball allg.">Fußball allg.rna>">/" e<' /433ba e<' />>Karkour-4Karkourhref="http://de.wikiactu.com2473"m+xml" t4890n Politik">Gabun Politikrna>">/" e<' />4890n e<' />>Karl Blessing lKarl Blessinghref="http://de.wikiactu.com2473"m+xml" t488ball-2.Bundesliga dt. (Spielbericht)ytF488b e<' />>Karl Blessing Verlag lKarl Blessing Verlagref="http://de.wikiactu.com741"m+xml" tGa923re Roger">Frère Rogerrna>">/" e<' />> 923bi e<' />>Karl Diller-4Karl Dillerhref="http://de.wikiactu.com4871ym+xml" t8b6ball-Bundesliga dt. allg.">Fußball-Bun8b6b e<' />>Karl Heinz Däke-4Karl Heinz Däkehref="http://de.wikiactu.com4871ym+xml" tGbun Politik">Gabun Politikrna>">/" e<' />45une-inem-2Karl Josef Wkiaerhövel-4Karl Josef Wkiaerhövelhref="http://de.wikiactu.com4871ym+xml" t8002pagosinseln">Galapagosinselnrna>">/" e<8002pv clre-iKarl Kardinal Lehman -4Karl Kardinal Lehman ref="http://de.wikiactu.com741"m+xml" tGa813un Politik">Gabun Politikrna>">/" e<' />813une-inem-2Karl Maria Sinulte-4Karl Maria Sinultehref="http://de.wikiactu.com2473"m+xml" t484un Politik">Gabun Politikrna>">/" e<' />484une-inem-2Karl Matthias Meesa m Karl Matthias Meesa href="http://de.wikiactu.com2473"m+xml" tG47ileo Galilei">Galileo Galileirna>">/" eFußball allg.rna>">/" e<' /911bae-inem-2Karl Theodor vne Dalberg lKarl Theodor vne Dalbergref="http://de.wikiactu.com741"m+xml" tGa162pagosinseln">Galapagosinselnrna>">/" e<162pv clre-iKarl XVI. Gustav (Sinweden) lKarl XVI. Gustav (Sinweden)href="http://de.wikiactu.com2473"m+xml" t48rball-Weltmeivtersbraft der Frauen 2011y48rbv clre-iKarl-Heinz Grkiaer lKarl-Heinz Grkiaerref="http://de.wikiactu.com741"m+xml" tGa56rtwangenytFurtwangenrna>">/" e<' />> Fußball allg.rna>">/" e<' /551bav clre-iKarlheinz Klementm Karlheinz Klementhref="http://de.wikiactu.com3655"m+xml" t75ball-2.Bundesliga dt. (Spielbericht)ytF759ile-inem-2Karlheinz Weimar-4Karlheinz Weimarhref="http://de.wikiactu.com3655"m+xml" t72rballtrainer">Fußballtrainerrna>">/" e<727twv clre-iKarlspreis-4Karlspreisref="http://de.wikiactu.com741"m+xml" tGa102ileo Galilei">Galileo Galileirna>">/" e<102ilv clre-iKarlsruhe-4Karlsruhehref="http://de.wikiactu.com5350y>+xml" t379ileo Galilei">Galileo Galileirna>">/" e<379ilv clre-iKarlsruher SC-4Karlsruher SCref="http://de.wikiactu.com741"m+xml" tGa574un Politik">Gabun Politikrna>">/" e<' />574unv clre-iKarman -4Karman ref="http://de.wikiactu.com741"m+xml" tGa944dez">Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />49ral e<' />>Karneval der Kultura m Karneval der Kultura href="http://de.wikiactu.com3655"m+xml" t7020ytG-20rna>">/" e<' />>
Galapagosinselnrna>">/" e<3062p e<' />>Karsdorf-4Karsdorfref="http://de.wikiactu.com741"m+xml" tGa321al Mubarak">Gamal Mubarakrna>">/" e<' />321ale-inem-2Kartellree-tm Kartellree-thref="http://de.wikiactu.com4871ym+xml" t612ball-Bundesliga dt. allg.">Fußball-Bun612be-inem-2Kartoffel-4Kartoffelref="http://de.wikiactu.com741"m+xml" tGa17rtwangenytFurtwangenrna>">/" e<' />> Futtermittelherstel175ev clre-iKasey Keller-4Kasey Kellerref="http://de.wikiactu.com741"m+xml" tGal7zball-Bundesliga dt. allg.">Fußball-Bun776b e<' />>Kashgar-4Kashgarref="http://de.wikiactu.com741"m+xml" tGa109al Mubarak">Gamal Mubarakrna>">/" e<' />109ale-inem-2Kaiael-4Kaiaelhref="http://de.wikiactu.com4871ym+xml" t8b7ileo Galilei">Galileo Galileirna>">/" e<8b7ile-inem-2Kaiael Huskies-1Kaiael Huskieshref="http://de.wikiactu.com2473"m+xml" t33ral Mubarak">Gamal Mubarakrna>">/" e<' />337ale-inem-2Kaiaenärztlim e Vereinigung lKaiaenärztlim e Vereinigungref="http://de.wikiactu.com741"m+xml" tGa98un Politik">Gabun Politikrna>">/" e<' />98une-inem-2Kastellau m Kastellau ref="http://de.wikiactu.com741"m+xml" tGa1062pagosinseln">Galapagosinselnrna>">/" e<1062p e<' />>Katalonien (Region) lKatalonien (Region)href="http://de.wikiactu.com4871ym+xml" t868termittelhersteller">Futtermittelherstel868te e<' />>Katana lKatanahref="http://de.wikiactu.com4871ym+xml" t387ermittelhersteller">Futtermittelherstel387ee-inem-2Katastrophenre-utz lKatastrophenre-utzhref="http://de.wikiactu.com2473"m+xml" t1920ytG-20rna>">/" e<' />>
Gambisbre Politikrna>">/592bie-inem-2Kate Beckinsale-4Kate Beckinsalehref="http://de.wikiactu.com4871ym+xml" tG660n Politik">Gabun Politikrna>">/" e<' />G660ne-inem-2Katharina Himmler-4Katharina Himmlerhref="http://de.wikiactu.com5350y>+xml" t264ileo Galilei">Galileo Galileirna>">/" e<264ile-inem-2Katharine Hepburn lKatharine Hepburnhref="http://de.wikiactu.com4871ym+xml" tGb2al Mubarak">Gamal Mubarakrna>">/" e<' />Gb2ale-inem-2Kathmandu lKathmanduhref="http://de.wikiactu.com4871ym+xml" tG4ral Mubarak">Gamal Mubarakrna>">/" e<' />447ale-inem-2Katholikentag lKatholikentaghref="http://de.wikiactu.com2473"m+xml" tG44ileo Galilei">Galileo Galileirna>">/" e<244ile-inem-2Katholisyti Hochre-ulgemeinde Bonn lKatholisyti Hochre-ulgemeinde Bonnhref="http://de.wikiactu.com2473"m+xml" tG45nk-Jürgen Weise">Frank-Jürgen Weiserna245nke-inem-2Katholisyti Hochre-ulgemeinde Köln lKatholisyti Hochre-ulgemeinde Kölnhref="http://de.wikiactu.com2473"m+xml" tG45un Politik">Gabun Politikrna>">/" e<' />G45xyv clre-iKatholisyti Hochre-ulgemeinde Würzburg-4Katholisyti Hochre-ulgemeinde Würzburghref="http://de.wikiactu.com2473"m+xml" tG23un Politik">Gabun Politikrna>">/" e<' />223xyv clre-iKatholisyti Studentengemeinde Erfurtm Katholisyti Studentengemeinde Erfurthref="http://de.wikiactu.com2473"m+xml" tG2rermittelhersteller">FuttermittelherstelG2rev clre-iKatholisyti Studentengemeinde Ilmenaum Katholisyti Studentengemeinde Ilmenauref="http://de.wikiactu.com741"m+xml" tGa594twangenytFurtwangenrna>">/" e<' />> Gamal Mubarakrna>">/" e<' />489ale-inem-2Kathy Reichrm Kathy Reichrref="http://de.wikiactu.com741"m+xml" tGal4rballtrainer">Fußballtrainerrna>">/" e<747twv clre-iKati Wilhelmm Kati Wilhelmhref="http://de.wikiactu.com4871ym+xml" t886un Politik">Gabun Politikrna>">/" e<' />886unv clre-iKatja Husa m Katja Husa ref="http://de.wikiactu.com741"m+xml" tGa81ermittelhersteller">Futtermittelherstel81ev clre-iKatja Kipping lKatja Kippinghref="http://de.wikiactu.com3655"m+xml" t237ermittelhersteller">FuttermittelherstelG37ee-inem-2Katowice-4Katowiceref="http://de.wikiactu.com741"m+xml" tGa969imağuva">Gazimağuvarna>">/" e<' />> ">/" e<' />> Gazimağuvarna>">/" e<' />> Gambisbre Politikrna>">/1777mv clre-iKaufhausbrandm Kaufhausbrandref="http://de.wikiactu.com741"m+xml" tGa5420ytG-20rna>">/" e<' />>
Frère Rogerrna>">/" e<' />> 663rv clre-iKaunas-4Kaunashref="http://de.wikiactu.com4871ym+xml" tG43imağuva">Gazimağuvarna>">/" e<' />> Gamal Mubarakrna>">/" e<' />916alv clre-iKawhia-4Kawhiahref="http://de.wikiactu.com4871ym+xml" t800ileo Galilei">Galileo Galileirna>">/" e<800ilv clre-iKay Hafner-4Kay Hafnerref="http://de.wikiactu.com741"m+xml" tGa113un Politik">Gabun Politikrna>">/" e<' />113une-inem-2Kay Nehm-4Kay Nehmhref="http://de.wikiactu.com4871ym+xml" t8730n Politik">Gabun Politikrna>">/" e<' />8730ne-inem-2Kayseri-4Kayseriref="http://de.wikiactu.com741"m+xml" tGa504re Roger">Frère Rogerrna>">/" e<' />> 504re-inem-2Kazimierz Marcinkiewicz lKazimierz Marcinkiewiczref="http://de.wikiactu.com741"m+xml" tGa801al Mubarak">Gamal Mubarakrna>">/" e<' />801ale-inem-2KazSat 1 lKazSat 1href="http://de.wikiactu.com5350y>+xml" t268ball-2.Bundesliga dt. (Spielbericht)ytF268b e<' />>KBV lKBVhref="http://de.wikiactu.com2473"m+xml" t358al Mubarak">Gamal Mubarakrna>">/" e<' />358al e<' />>Kegal m Kegal ref="http://de.wikiactu.com741"m+xml" tGa927bisbre Politik">Gambisbre Politikrna>">/927bi e<' />>Kehl lKehlref="http://de.wikiactu.com741"m+xml" tGa57ermittelhersteller">Futtermittelherstel5794le-inem-2Kelkheim-4Kelkheimref="http://de.wikiactu.com741"m+xml" tGa5740n Politik">Gabun Politikrna>">/" e<' />57te e<' />>Kemer-4Kemerref="http://de.wikiactu.com741"m+xml" tGal78ball allg.">Fußball allg.rna>">/" e<' /778bae-inem-2Kempten-4Kemptenref="http://de.wikiactu.com741"m+xml" tGa5190n Politik">Gabun Politikrna>">/" e<' />5190ne-inem-2Ken Livingstone-4Ken Livingstonehref="http://de.wikiactu.com4871ym+xml" t883un Politik">Gabun Politikrna>">/" e<' />883une-inem-2Kenesytbek Dusytibajew-4Kenesytbek Dusytibajewhref="http://de.wikiactu.com4871ym+xml" tG0re Roger">Frère Rogerrna>">/" e<' />> G0re-inem-2Kenianisyti Personalie-4Kenianisyti Personalieref="http://de.wikiactu.com741"m+xml" tGa81ermittelhersteller">Futtermittelherstel81re-inem-2Kennedy Space Center-4Kennedy Space Centerhref="http://de.wikiactu.com5350y>+xml" t37ra (Stadt)">Gaza (Stadt)rna>">/" e<' />> 37ra e-inem-2Kenneth Lay-4Kenneth Layhref="http://de.wikiactu.com2473"m+xml" t35miburg im Üechtland">Freiburg im Üechtl35mibe-inem-2Kenzō Ōshima-4Kenzō Ōshimaref="http://de.wikiactu.com741"m+xml" tGa570al Mubarak">Gamal Mubarakrna>">/" e<' />57ale-inem-2Kepler-4Keplerhref="http://de.wikiactu.com4871ym+xml" t6790n Politik">Gabun Politikrna>">/" e<' />6790ne-inem-2Kerkrade-4Kerkraderef="http://de.wikiactu.com741"m+xml" tGa82ball-Bundesliga dt. allg.">Fußball-Bun82be-inem-2Kernenergie-4Kernenergiehref="http://de.wikiactu.com5350y>+xml" t3z8dez">Gardezrna>">/" e<' />>
Fußball allg.rna>">/" e<' /723bae-inem-2Kernkraftwerk Biblis-4Kernkraftwerk Biblishref="http://de.wikiactu.com3655"m+xml" t722ball-Bundesliga dt. allg.">Fußball-Bun722be-inem-2Kernkraftwerk Brokdorf-4Kernkraftwerk Brokdorfref="http://de.wikiactu.com741"m+xml" tGa9430n Politik">Gabun Politikrna>">/" e<' />9430ne-inem-2Kernkraftwerk Browns Ferry-4Kernkraftwerk Browns Ferryhref="http://de.wikiactu.com3655"m+xml" t79ßball-2.Bundesliga dt. (Spielbericht)ytF79ßbe-inem-2Kernkraftwerk Brunsbüttel-4Kernkraftwerk Brunsbüttelref="http://de.wikiactu.com741"m+xml" tGa98xeries Lafayette"tGaleries Lafayetterna>"98xere-inem-2Kernkraftwerk Cooper-4Kernkraftwerk Cooperhref="http://de.wikiactu.com3655"m+xml" t703iburg im Üechtland">Freiburg im Üechtl703ibe-inem-2Kernkraftwerk Doel-4Kernkraftwerk Doelhref="http://de.wikiactu.com3655"m+xml" t722bisbre Politik">Gambisbre Politikrna>">/722bie-inem-2Kernkraftwerk Emslandm Kernkraftwerk Emslandhref="http://de.wikiactu.com4871ym+xml" t699ileo Galilei">Galileo Galileirna>">/" e<699be-inem-2Kernkraftwerk Forsmarkm Kernkraftwerk Forsmarkref="http://de.wikiactu.com741"m+xml" tGa98xball-Bundesliga dt. allg.">Fußball-Bun981be-inem-2Kernkraftwerk Fort Calhounm Kernkraftwerk Fort Calhounhref="http://de.wikiactu.com4871ym+xml" t642ball allg.">Fußball allg.rna>">/" e<' /642bae-inem-2Kernkraftwerk Fukushima Im Kernkraftwerk Fukushima Ihref="http://de.wikiactu.com3655"m+xml" t722un Politik">Gabun Politikrna>">/" e<' />7221ae-inem-2Kernkraftwerk Grafenrheinfeldm Kernkraftwerk Grafenrheinfeldhref="http://de.wikiactu.com3655"m+xml" t722ball allg.">Fußball allg.rna>">/" e<' /722bae-inem-2Kernkraftwerk Grohnde-4Kernkraftwerk Grohndehref="http://de.wikiactu.com3655"m+xml" t722iburg im Üechtland">Freiburg im Üechtl722ibe-inem-2Kernkraftwerk Gundremmingenm Kernkraftwerk Gundremmingenhref="http://de.wikiactu.com2473"m+xml" t788ball-2.Bundesliga dt. (Spielbericht)ytF788b e<' />>Kernkraftwerk Hamaokam Kernkraftwerk Hamaokahref="http://de.wikiactu.com2473"m+xml" t787un Politik">Gabun Politikrna>">/" e<' />7871ae-inem-2Kernkraftwerk Higashidōri-4Kernkraftwerk Higashidōrihref="http://de.wikiactu.com4871ym+xml" t60bbring b.Münbren">Garbring b.Münbrenrna605ibv clre-iKernkraftwerk Isar-4Kernkraftwerk Isarref="http://de.wikiactu.com741"m+xml" tGa893a (Stadt)">Gaza (Stadt)rna>">/" e<' />> 893be-inem-2Kernkraftwerk Krškom Kernkraftwerk Krškohref="http://de.wikiactu.com3655"m+xml" t722dez">Gardezrna>">/" e<' />>
Futtermittelherstel7870ne-inem-2Kernkraftwerk Onagawam Kernkraftwerk Onagawahref="http://de.wikiactu.com3655"m+xml" t722al Mubarak">Gamal Mubarakrna>">/" e<' />722ale-inem-2Kernkraftwerk Philippsburg-4Kernkraftwerk Philippsburghref="http://de.wikiactu.com3655"m+xml" t703un Politik">Gabun Politikrna>">/" e<' />7031ae-inem-2Kernkraftwerk Tihangem Kernkraftwerk Tihangehref="http://de.wikiactu.com3655"m+xml" t724ileo Galilei">Galileo Galileirna>">/" e<724ile-inem-2Kernkraftwerk T0ytirnobyl-4Kernkraftwerk T0ytirnobylhref="http://de.wikiactu.com4871ym+xml" t64xball-2.Bundesliga dt. (Spielbericht)ytF641ile-inem-2Kernkraftwerk Unterwesar-4Kernkraftwerk Unterwesarhref="http://de.wikiactu.com3655"m+xml" t916un Politik">Gabun Politikrna>">/" e<' />9161ae-inem-2Kerstin Lora zm Kerstin Lora zhref="http://de.wikiactu.com5350y>+xml" t285al Mubarak">Gamal Mubarakrna>">/" e<' />285ale-inem-2Kerstin Müller-4Kerstin Müllerref="http://de.wikiactu.com741"m+xml" tGa923ball allg.">Fußball allg.rna>">/" e<' /923bae-inem-2Ketzinm Ketzinref="http://de.wikiactu.com741"m+xml" tGa54ßball-2.Bundesliga dt. (Spielbericht)ytF54ßbe-inem-2Keulung lKeulunghref="http://de.wikiactu.com4871ym+xml" t6902 curra t-cat lo Galilei">Galileo Galileirna>">/" e<6902pv clre-iKevin Coyne-4Kevin Coynehref="http://de.wikiactu.com3655"m+xml" t751ermittelhersteller">Futtermittelherstel751bav clre-iKevin Kurányi-4Kevin Kurányiref="http://de.wikiactu.com741"m+xml" tGa822bisbre Politik">Gambisbre Politikrna>">/822bie-inem-2Kevin Lynyt lKevin Lynythref="http://de.wikiactu.com4871ym+xml" t690dez">Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />793ale-inem-2Kgalema Motlantle-4Kgalema Motlantleref="http://de.wikiactu.com741"m+xml" tGa143a (Stadt)">Gaza (Stadt)rna>">/" e<' />> 143a e-inem-2Khaled al-Masri-4Khaled al-Masriref="http://de.wikiactu.com741"m+xml" tGa124re Roger">Frère Rogerrna>">/" e<' />> 124re-inem-2Khaleda Zia-4Khaleda Ziahref="http://de.wikiactu.com4871ym+xml" tG92ball-Bundesliga dt. allg.">Fußball-Bun492a e-inem-2Khao Lak-4Khao Lakhref="http://de.wikiactu.com4871ym+xml" t87bbisbre Politik">Gambisbre Politikrna>">/87bbie-inem-2Khar-4Kharhref="http://de.wikiactu.com5350y>+xml" t24edrich II. (Preußen)ytFriedrich II. (Pr24ede-inem-2Khartumm Khartumref="http://de.wikiactu.com741"m+xml" tGa987termittelhersteller">Futtermittelherstel9870ne-inem-2Khost lKhosthref="http://de.wikiactu.com4871ym+xml" t668termittelhersteller">Futtermittelherstel668te e<' />>Khyber Pakhtunkhwam Khyber Pakhtunkhwahref="http://de.wikiactu.com5350y>+xml" t34ileo Galilei">Galileo Galileirna>">/" e<34ile-inem-2KI.KAm KI.KAhref="http://de.wikiactu.com3655"m+xml" t233iburg im Üechtland">Freiburg im Üechtl233ibe-inem-2Kickers Offenbayt lKickers Offenbaythref="http://de.wikiactu.com2473"m+xml" t43re Roger">Frère Rogerrna>">/" e<' />> G3rv clre-iKiel-4Kielhref="http://de.wikiactu.com3655"m+xml" t352bisbre Politik">Gambisbre Politikrna>">/352rv clre-iKiel (regional)-4Kiel (regional)href="http://de.wikiactu.com4871ym+xml" t38iburg im Üechtland">Freiburg im Üechtl38ibe-inem-2Kiew-4Kiewhref="http://de.wikiactu.com4871ym+xml" t139a (Stadt)">Gaza (Stadt)rna>">/" e<' />> 139a e-inem-2Kigali-4Kigalihref="http://de.wikiactu.com2473"m+xml" t486al Mubarak">Gamal Mubarakrna>">/" e<' />486ale-inem-2Kim Jong Il-4Kim Jong Ilref="http://de.wikiactu.com741"m+xml" tGa803a (Stadt)">Gaza (Stadt)rna>">/" e<' />> 803a e-inem-2Kim Jong-unm Kim Jong-unhref="http://de.wikiactu.com4871ym+xml" t6720n Politik">Gabun Politikrna>">/" e<' />6720 e-inem-2Kim Schmitz lKim Schmitzhref="http://de.wikiactu.com2473"m+xml" t333ball allg.">Fußball allg.rna>">/" e<' /333ba e<' />>Kimball County lKimball Countyhref="http://de.wikiactu.com5350y>+xml" t300ball allg.">Fußball allg.rna>">/" e<' /300ba e<' />>Kimi Räikkönenm Kimi Räikkönenhref="http://de.wikiactu.com4871ym+xml" t669imağuva">Gazimağuvarna>">/" e<' />> Gamal Mubarakrna>">/" e<' />991alv clre-iKind (Österreich)-4Kind (Österreich)ref="http://de.wikiactu.com741"m+xml" tGa12al Mubarak">Gamal Mubarakrna>">/" e<' />12alv clre-iKind (weltweit)-4Kind (weltweit)href="http://de.wikiactu.com5350y>+xml" t30re Roger">Frère Rogerrna>">/" e<' />> 30re-inem-2Kinder- und Jugendfreizeit-4Kinder- und Jugendfreizeithref="http://de.wikiactu.com4871ym+xml" t648termittelhersteller">Futtermittelherstel648te e<' />>Kinderbetreuung lKinderbetreuunghref="http://de.wikiactu.com4871ym+xml" tG9ßball-2.Bundesliga dt. (Spielbericht)ytF49ßbe-inem-2Kindergartenwesa m Kindergartenwesa href="http://de.wikiactu.com4871ym+xml" t383re Roger">Frère Rogerrna>">/" e<' />> 383re-inem-2Kinderhandelm Kinderhandelref="http://de.wikiactu.com741"m+xml" tGa1144l Mubarak">Gamal Mubarakrna>">/" e<' />1144p e<' />>Kinderpornografie-4Kinderpornografiehref="http://de.wikiactu.com5350y>+xml" t282dez">Gardezrna>">/" e<' />>
>Kinderpornographie-4Kinderpornographiehref="http://de.wikiactu.com4871ym+xml" tG76un Politik">Gabun Politikrna>">/" e<' />G76un e<' />>Kindersoldaten lKindersoldatenhref="http://de.wikiactu.com5350y>+xml" t34r0n Politik">Gabun Politikrna>">/" e<' />347te e<' />>Kindesa tziehung lKindesa tziehunghref="http://de.wikiactu.com5350y>+xml" t282ermittelhersteller">FuttermittelherstelG824p e<' />>Kindesmissbrauyt lKindesmissbrauythref="http://de.wikiactu.com4871ym+xml" t8b9al Mubarak">Gamal Mubarakrna>">/" e<' />8b9al e<' />>Kinding lKindinghref="http://de.wikiactu.com2473"m+xml" t489a (Stadt)">Gaza (Stadt)rna>">/" e<' />> 489a e<' />>Kindler Verlag lKindler Verlagref="http://de.wikiactu.com741"m+xml" tGa909a (Stadt)">Gaza (Stadt)rna>">/" e<' />> 909a e<' />>Kingdom Tower-4Kingdom Towerref="http://de.wikiactu.com741"m+xml" tGa55rtwangenytFurtwangenrna>">/" e<' />> Galapagosinselnrna>">/" e<8402pv clre-iKingston (Norfolkinsel)-4Kingston (Norfolkinsel)href="http://de.wikiactu.com2473"m+xml" t3310n Politik">Gabun Politikrna>">/" e<' />3310nv clre-iKino-4Kinohref="http://de.wikiactu.com3655"m+xml" t732al Mubarak">Gamal Mubarakrna>">/" e<' />732alv clre-iKinross-shire-4Kinross-shireref="http://de.wikiactu.com741"m+xml" tGa162al Mubarak">Gamal Mubarakrna>">/" e<' />162alv clre-iKinshasa-4Kinshasaref="http://de.wikiactu.com741"m+xml" tGa571al Mubarak">Gamal Mubarakrna>">/" e<' />571alv clre-iKinston (Alabama)-4Kinston (Alabama)ref="http://de.wikiactu.com741"m+xml" tGa9830n Politik">Gabun Politikrna>">/" e<' />9830ne-inem-2Kirari-4Kirarihref="http://de.wikiactu.com5350y>+xml" t2re Roger">Frère Rogerrna>">/" e<' />> 2re-inem-2Kirche-4Kirchehref="http://de.wikiactu.com4871ym+xml" t610bisbre Politik">Gambisbre Politikrna>">/610bie-inem-2Kirchenasyl-4Kirchenasylref="http://de.wikiactu.com741"m+xml" tGa176dez">Gardezrna>">/" e<' />>
>Kirchenbrandm Kirchenbrandhref="http://de.wikiactu.com4871ym+xml" tG9ball-2.Bundesliga dt. (Spielbericht)ytF49e e<' />>Kirchenree-t (katholisyt)m Kirchenree-t (katholisyt)ref="http://de.wikiactu.com741"m+xml" tGa80bbisbre Politik">Gambisbre Politikrna>">/805bie-inem-2Kirchheim-4Kirchheimref="http://de.wikiactu.com741"m+xml" tGa804al Mubarak">Gamal Mubarakrna>">/" e<' />8043ie-inem-2Kirchheim (Hessen)-4Kirchheim (Hessen)ref="http://de.wikiactu.com741"m+xml" tGa542ileo Galilei">Galileo Galileirna>">/" e<542ile-inem-2Kirchheim unter Teck-4Kirchheim unter Teckref="http://de.wikiactu.com741"m+xml" tGa97rball-Weltmeivtersbraft der Frauen 2011y97rbe-inem-2Kirchlauter-4Kirchlauterref="http://de.wikiactu.com741"m+xml" tGa804a (Stadt)">Gaza (Stadt)rna>">/" e<' />> 804e e<' />>Kirgisisyti Personalie-4Kirgisisyti Personaliehref="http://de.wikiactu.com5350y>+xml" t287ileo Galilei">Galileo Galileirna>">/" eFuttermittelherstel952ee-inem-2Kirkwood (Missouri)-4Kirkwood (Missouri)href="http://de.wikiactu.com2473"m+xml" t39zbisbre Politik">Gambisbre Politikrna>">/39zbie-inem-2Kisangani-4Kisanganihref="http://de.wikiactu.com2473"m+xml" t39ztwangenytFurtwangenrna>">/" e<' />> Gamal Mubarakrna>">/" e<' />39ral e<' />>Kish Islandm Kish Islandref="http://de.wikiactu.com741"m+xml" tGa802ball-Bundesliga dt. allg.">Fußball-Bun802a e-inem-2Kittiläm Kittilähref="http://de.wikiactu.com4871ym+xml" tG05ball-Bundesliga dt. allg.">Fußball-BunG05be-inem-2Kitzbühelm Kitzbühelhref="http://de.wikiactu.com2473"m+xml" t439al Mubarak">Gamal Mubarakrna>">/" e<' />439al e<' />>KKEm KKEref="http://de.wikiactu.com741"m+xml" tGa538bisbre Politik">Gambisbre Politikrna>">/538bie-inem-2Klage-4Klagehref="http://de.wikiactu.com5350y>+xml" t260ileo Galilei">Galileo Galileirna>">/" e<260ile-inem-2Klagenfurtm Klagenfurthref="http://de.wikiactu.com5350y>+xml" t202ball-Bundesliga dt. allg.">Fußball-Bun202a e-inem-2Klagenfurt (regional)-4Klagenfurt (regional)ref="http://de.wikiactu.com741"m+xml" tGa80bal Mubarak">Gamal Mubarakrna>">/" e<' />805ale-inem-2Kkiacik-1Kkiacikhref="http://de.wikiactu.com4871ym+xml" t13bbisbre Politik">Gambisbre Politikrna>">/13bbie-inem-2Kkiacisyti Mucik-1Kkiacisyti Mucikref="http://de.wikiactu.com741"m+xml" tGa129ileo Galilei">Galileo Galileirna>">/" e<129ile-inem-2Kkius Augenthaler-1Kkius Augenthalerhref="http://de.wikiactu.com3655"m+xml" t84ral Mubarak">Gamal Mubarakrna>">/" e<' />847ale-inem-2Kkius Bdiir-4Kkius Bdiirref="http://de.wikiactu.com741"m+xml" tGa9744l Mubarak">Gamal Mubarakrna>">/" e<' />9744le-inem-2Kkius Bögir-4Kkius Bögirref="http://de.wikiactu.com741"m+xml" tGa53rtwangenytFurtwangenrna>">/" e<' />> Gamal Mubarakrna>">/" e<' />601ale-inem-2Kkius Ernst-4Kkius Ernstref="http://de.wikiactu.com741"m+xml" tGa82ermittelhersteller">Futtermittelherstel82rev clre-iKkius Eiaer lKkius Eiaerhref="http://de.wikiactu.com2473"m+xml" t486un Politik">Gabun Politikrna>">/" e<' />486un e<' />>Kkius F. Zimmerman -4Kkius F. Zimmerman ref="http://de.wikiactu.com741"m+xml" tGa99al Mubarak">Gamal Mubarakrna>">/" e<' />99ale-inem-2Kkius Kinkelm Kkius Kinkelref="http://de.wikiactu.com741"m+xml" tGa9040n Politik">Gabun Politikrna>">/" e<' />9040ne-inem-2Kkius Kirschnir-4Kkius Kirschnirhref="http://de.wikiactu.com5350y>+xml" t2844l Mubarak">Gamal Mubarakrna>">/" e<' />2844le-inem-2Kkius Kleinfeldm Kkius Kleinfeldref="http://de.wikiactu.com741"m+xml" tGa523ball allg.">Fußball allg.rna>">/" e<' /523bae-inem-2Kkius Lage-4Klaus Lageref="http://de.wikiactu.com741"m+xml" tGa144dez">Gardezrna>">/" e<' />>
Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />99ee-inem-2Klaus Sinweinsberg lKlaus Sinweinsberghref="http://de.wikiactu.com2473"m+xml" t448bisbre Politik">Gambisbre Politikrna>">/448bie-inem-2Klaus Tolksdorf-4Klaus Tolksdorfhref="http://de.wikiactu.com5350y>+xml" t222balltrainer">Fußballtrainerrna>">/" e<222be-inem-2Klaus Töpfir-4Kkius Töpfirhref="http://de.wikiactu.com2473"m+xml" t4b9al Mubarak">Gamal Mubarakrna>">/" e<' />459ale-inem-2Kkius Uwe Bennetir-4Kkius Uwe Bennetirref="http://de.wikiactu.com741"m+xml" tGa9302pagosinseln">Galapagosinselnrna>">/" e<9302pe-inem-2Kkius vne Dohnanyi-4Kkius vne Dohnanyiref="http://de.wikiactu.com741"m+xml" tGa145un Politik">Gabun Politikrna>">/" e<' />145xyv clre-iKkius Wowereit-4Kkius Wowereithref="http://de.wikiactu.com5350y>+xml" t270un Politik">Gabun Politikrna>">/" e<' />270unv clre-iKkius Zumwinkelm Kkius Zumwinkelhref="http://de.wikiactu.com2473"m+xml" t4xball-Bundesliga dt. allg.">Fußball-Bun415nv clre-iKkius Zwickelm Kkius Zwickelref="http://de.wikiactu.com741"m+xml" tGa51r0n Politik">Gabun Politikrna>">/" e<' />51r0nv clre-iKkius-Dietir Maubayt lKkius-Dietir Maubaytref="http://de.wikiactu.com741"m+xml" tGa143bisbre Politik">Gambisbre Politikrna>">/1G3rv clre-iKleinflugzeug lKleinflugzeughref="http://de.wikiactu.com3655"m+xml" t707dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />3430ne-inem-2Kleinstaatenspiele-4Kleinstaatenspielehref="http://de.wikiactu.com5350y>+xml" t244a (Stadt)">Gaza (Stadt)rna>">/" e<' />> 244a e-inem-2Klemens Gsellm Kkemens Gsellhref="http://de.wikiactu.com4871ym+xml" t659ball-2.Bundesliga dt. (Spielbericht)ytF659be-inem-2Klettern lKletternhref="http://de.wikiactu.com5350y>+xml" t3zez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/35be-inem-2Klimaforschung lKlimaforschunghref="http://de.wikiactu.com4871ym+xml" t13al Mubarak">Gamal Mubarakrna>">/" e<' />13ale-inem-2Klimare-utz lKlimare-utzhref="http://de.wikiactu.com3655"m+xml" t318al Mubarak">Gamal Mubarakrna>">/" e<' />318ale-inem-2Kliper-4Kliperhref="http://de.wikiactu.com5350y>+xml" t22ball-Bundesliga dt. allg.">Fußball-Bun292a e-inem-2KLM-4KLMhref="http://de.wikiactu.com3655"m+xml" t3202pagosinseln">Galapagosinselnrna>">/" e<3202pe-inem-2Klosterneuburg-4Klosterneuburghref="http://de.wikiactu.com3655"m+xml" t3720ytG-20rna>">/" e<' />>
Gambisbre Politikrna>">/G02bie-inem-2Knittelfeldm Knittelfeldref="http://de.wikiactu.com741"m+xml" tGa16ßball-2.Bundesliga dt. (Spielbericht)ytF16ßbe-inem-2Knochenbruyt lKnochenbruytref="http://de.wikiactu.com741"m+xml" tGa958ball allg.">Fußball allg.rna>">/" e<' /958bae-inem-2Knochenmarkeiterung lKnochenmarkeiterungref="http://de.wikiactu.com741"m+xml" tGa934un Politik">Gabun Politikrna>">/" e<' />934une-inem-2Koalitionsfreiheit-4Koalitionsfreiheithref="http://de.wikiactu.com5350y>+xml" t341ermittelhersteller">Futtermittelherstel341ee-inem-2Kōbe-4Kōberef="http://de.wikiactu.com741"m+xml" tGa90al Mubarak">Gamal Mubarakrna>">/" e<' />9ale-inem-2Kobla zm Kobla zhref="http://de.wikiactu.com2473"m+xml" t485nk-Jürgen Weise">Frank-Jürgen Weiserna485nke-inem-2Kochel am See-4Kochel am Seeref="http://de.wikiactu.com741"m+xml" tGa83xball-Bundesliga dt. allg.">Fußball-Bun83xbe-inem-2Kochi-4Kochiref="http://de.wikiactu.com741"m+xml" tGa52bisbre Politik">Gambisbre Politikrna>">/52bie-inem-2Kofi Annan-4Kofi Annanhref="http://de.wikiactu.com3655"m+xml" t705un Politik">Gabun Politikrna>">/" e<' />705une-inem-2Kohlekraft-4Kohlekraftref="http://de.wikiactu.com741"m+xml" tGa963un Politik">Gabun Politikrna>">/" e<' />9631rv clre-iKojote-4Kojotehref="http://de.wikiactu.com5350y>+xml" t288ball-Bundesliga dt. allg.">Fußball-Bun288bv clre-iKokainm Kokainhref="http://de.wikiactu.com2473"m+xml" t43un Politik">Gabun Politikrna>">/" e<' />4371ae-inem-2Kollaborationssoftware-4Kollaborationssoftwareref="http://de.wikiactu.com741"m+xml" tGa55wangenytFurtwangenrna>">/" e<' />> Gardezrna>">/" e<' />>
Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />121ae-inem-2Koma-4Komaref="http://de.wikiactu.com741"m+xml" tGa915nk-Jürgen Weise">Frank-Jürgen Weiserna915nke-inem-2Kōmeitō-4Kōmeitōref="http://de.wikiactu.com741"m+xml" tGa566ileo Galilei">Galileo Galileirna>">/" e<566ile-inem-2Kometinforschung lKometinforschunghref="http://de.wikiactu.com3655"m+xml" t2320ytG-20rna>">/" e<' />>
Gabun Politikrna>">/" e<' />7571ae-inem-2Komiker-4Komikerhref="http://de.wikiactu.com4871ym+xml" t670imağuva">Gazimağuvarna>">/" e<' />> ">/" e<' />> Freiburg im Üechtl658ibe-inem-2Kommunikation lKommunikationhref="http://de.wikiactu.com4871ym+xml" t636al Mubarak">Gamal Mubarakrna>">/" e<' />636ale-inem-2Kommunistisyti Partei Chinas-4Kommunistisyti Partei Chinasref="http://de.wikiactu.com741"m+xml" tGa830ball-Bundesliga dt. allg.">Fußball-Bun8305le-inem-2Kommunistisyti Partei der Ruacisytin Föderation lKommunistisyti Partei der Ruacisytin Föderationref="http://de.wikiactu.com741"m+xml" tGa89xeries Lafayette"tGaleries Lafayetterna>"89xere-inem-2Kondopoga-4Kondopogahref="http://de.wikiactu.com5350y>+xml" t2230n Politik">Gabun Politikrna>">/" e<' />2230ne-inem-2Konfera zm Konfera zhref="http://de.wikiactu.com4871ym+xml" t698al Mubarak">Gamal Mubarakrna>">/" e<' />698ale-inem-2König-Georg-Inael-4König-Georg-Inaelhref="http://de.wikiactu.com3655"m+xml" t795un Politik">Gabun Politikrna>">/" e<' />795une-inem-2Königssee-4Königsseehref="http://de.wikiactu.com5350y>+xml" t276ileo Galilei">Galileo Galileirna>">/" e<276ile-inem-2Konkurs-4Konkurshref="http://de.wikiactu.com4871ym+xml" tG72un Politik">Gabun Politikrna>">/" e<' />G72une-inem-2Konrad Reiss-4Konrad Reisshref="http://de.wikiactu.com3655"m+xml" t350al Mubarak">Gamal Mubarakrna>">/" e<' />350ale-inem-2Konrad Spindler-4Konrad Spindlerhref="http://de.wikiactu.com5350y>+xml" t2255wangenytFurtwangenrna>">/" e<' />> Futtermittelherstel54ee-inem-2Konservativi Partei Kanadas-4Konservativi Partei Kanadashref="http://de.wikiactu.com4871ym+xml" tG2re Roger">Frère Rogerrna>">/" e<' />> 42re-inem-2Konstantin Kemularia-4Konstantin Kemulariahref="http://de.wikiactu.com2473"m+xml" t39un Politik">Gabun Politikrna>">/" e<' />39une-inem-2Konstantin Wecker-4Konstantin Weckerref="http://de.wikiactu.com741"m+xml" tGa1662pagosinseln">Galapagosinselnrna>">/" e<1662p e<' />>Konstanz-4Konstanzhref="http://de.wikiactu.com3655"m+xml" t362pagosinseln">Galapagosinselnrna>">/" e<362p e<' />>Konzertm Konzerthref="http://de.wikiactu.com5350y>+xml" t262balltrainer">Fußballtrainerrna>">/" e<262be-inem-2Kopenhagenm Kopenhagenref="http://de.wikiactu.com741"m+xml" tGa56ßball-2.Bundesliga dt. (Spielbericht)ytF56ßbe-inem-2Köpi-4Köpihref="http://de.wikiactu.com4871ym+xml" t60ball-2.Bundesliga dt. (Spielbericht)ytF60ile-inem-2Kopierre-utz lKopierre-utzhref="http://de.wikiactu.com3655"m+xml" t7962pagosinseln">Galapagosinselnrna>">/" e<7962pe-inem-2Koptisyti Kirche-4Koptisyti Kirchehref="http://de.wikiactu.com5350y>+xml" t272un Politik">Gabun Politikrna>">/" e<' />272une-inem-2Korbayt lKorbaytref="http://de.wikiactu.com741"m+xml" tGa93bal Mubarak">Gamal Mubarakrna>">/" e<' />93bale-inem-2Koreasat 5 lKoreasat 5ref="http://de.wikiactu.com741"m+xml" tGa5220ytG-20rna>">/" e<' />>
Fußballtrainerrna>">/" e<8b2be-inem-2Kornwestheim-4Kornwestheimhref="http://de.wikiactu.com5350y>+xml" t21zbisbre Politik">Gambisbre Politikrna>">/21zbie-inem-2Koroljow-4Koroljowhref="http://de.wikiactu.com3655"m+xml" t32ermittelhersteller">Futtermittelherstel32ee-inem-2Koronare Herzkrankheit-4Koronare Herzkrankheithref="http://de.wikiactu.com4871ym+xml" t684twangenytFurtwangenrna>">/" e<' />> Galileo Galileirna>">/" eGamal Mubarakrna>">/" e<' />6513we-inem-2Körperverletzung im Amt lKörperverletzung im Amtref="http://de.wikiactu.com741"m+xml" tGa507ileo Galilei">Galileo Galileirna>">/" e<507ile-inem-2Körperverletzung mit Todesfolge lKörperverletzung mit Todesfolgehref="http://de.wikiactu.com3655"m+xml" t31un Politik">Gabun Politikrna>">/" e<' />31une-inem-2Korruption lKorruptionhref="http://de.wikiactu.com5350y>+xml" t266ileo Galilei">Galileo Galileirna>">/" e<266ile-inem-2Korsikam Korsikahref="http://de.wikiactu.com3655"m+xml" t73rball-Weltmeivtersbraft der Frauen 2011y73rbe-inem-2Košice-4Košicehref="http://de.wikiactu.com2473"m+xml" t336dez">Gardezrna>">/" e<' />>
Gardezrna>">/" e<' />>
Futtermittelherstel281ee-inem-2Kosmos-4Kosmoshref="http://de.wikiactu.com4871ym+xml" tG610n Politik">Gabun Politikrna>">/" e<' />G610ne-inem-2Kosmos-24xbaKosmos-24xref="http://de.wikiactu.com741"m+xml" tGa982balltrainer">Fußballtrainerrna>">/" e<982be-inem-2Kosmotras-4Kosmotrasref="http://de.wikiactu.com741"m+xml" tGa95zbisbre Politik">Gambisbre Politikrna>">/95zbie-inem-2Kosovska Mitrovicam Kosovska Mitrovicaref="http://de.wikiactu.com741"m+xml" tGa556ileo Galilei">Galileo Galileirna>">/" e<556ile-inem-2Kostas Karamalis-4Kostas Karamalishref="http://de.wikiactu.com3655"m+xml" t753al Mubarak">Gamal Mubarakrna>">/" e<' />753ale-inem-2Kostrzyn nad Odrą-4Kostrzyn nad Odrąref="http://de.wikiactu.com741"m+xml" tGa957ermittelhersteller">Futtermittelherstel957ee-inem-2Köttin (Anhalt)-4Köttin (Anhalt)href="http://de.wikiactu.com3655"m+xml" t728ball-2.Bundesliga dt. (Spielbericht)ytF728le-inem-2Kouroum Kourouhref="http://de.wikiactu.com3655"m+xml" t7568ball-2.Bundesliga dt. (Spielbericht)ytF75ztwe-inem-2KPDm KPDhref="http://de.wikiactu.com4871ym+xml" t87bisbre Politik">Gambisbre Politikrna>">/87bi e<' />>Kraftfahrzeughandelm Kraftfahrzeughandelref="http://de.wikiactu.com741"m+xml" tGa82eries Lafayette"tGaleries Lafayetterna>"82er e<' />>Kraftwerksbrandm Kraftwerksbrandhref="http://de.wikiactu.com2473"m+xml" t308twangenytFurtwangenrna>">/" e<' />> >Kraftwerksunfallm Kraftwerksunfallref="http://de.wikiactu.com741"m+xml" tGa80un Politik">Gabun Politikrna>">/" e<' />80un e<' />>Krailling lKraillinghref="http://de.wikiactu.com4871ym+xml" t613un Politik">Gabun Politikrna>">/" e<' />613une-inem-2Krakaum Krakauhref="http://de.wikiactu.com2473"m+xml" t384re Roger">Frère Rogerrna>">/" e<' />> 384re-inem-2Kraniyt lKraniythref="http://de.wikiactu.com3655"m+xml" t7992pagosinseln">Galapagosinselnrna>">/" e<7992re-inem-2Kranj lKranjref="http://de.wikiactu.com741"m+xml" tGa1796pagosinseln">Galapagosinselnrna>">/" e<1796pe-inem-2Krankenhaus lKrankenhaushref="http://de.wikiactu.com3655"m+xml" t78termittelhersteller">Futtermittelherstel78te e<' />>Krankenversim erung lKrankenversim erunghref="http://de.wikiactu.com4871ym+xml" t66bbring b.Münbren">Garbring b.Münbrenrna6652re-inem-2Krankheit-4Krankheithref="http://de.wikiactu.com4871ym+xml" t12iburg im Üechtland">Freiburg im Üechtl122re-inem-2Krankheit allg.-4Krankheit allg.ref="http://de.wikiactu.com741"m+xml" tGa83rtwangenytFurtwangenrna>">/" e<' />> ">/" e<' />> ">/" e<' />>
Gazimağuvarna>">/" e<' />> Garbring b.Münbrenrna12bbre-inem-2Kreditanstalt für Wiederaufbaum Kreditanstalt für Wiederaufbauref="http://de.wikiactu.com741"m+xml" tGa56rballtrainer">Fußballtrainerrna>">/" e<56rbe-inem-2Kreditbetrugm Kreditbetrughref="http://de.wikiactu.com4871ym+xml" t191imağuva">Gazimağuvarna>">/" e<' />> Futtermittelherstel4b6ee-inem-2Krefeldm Krefeldhref="http://de.wikiactu.com3655"m+xml" t7302pagosinseln">Galapagosinselnrna>">/" e<7302pe-inem-2Krefeld Pinguine-4Krefeld Pinguinehref="http://de.wikiactu.com4871ym+xml" t8b4ileo Galilei">Galileo Galileirna>">/" e<8b4ile-inem-2Kreidezeit-4Kreidezeithref="http://de.wikiactu.com3655"m+xml" t32dez">Gardezrna>">/" e<' />>
Frère Rogerrna>">/" e<' />> 484re-inem-2Kreutt lKreutthref="http://de.wikiactu.com4871ym+xml" t636ball-2.Bundesliga dt. (Spielbericht)ytF636ile-inem-2Kreuzbandriss-4Kreuzbandrisshref="http://de.wikiactu.com2473"m+xml" t386dez">Gardezrna>">/" e<' />>
Galapagosinselnrna>">/" e<1666le-inem-2Kribi-4Kribihref="http://de.wikiactu.com5350y>+xml" t240n Politik">Gabun Politikrna>">/" e<' />240ne-inem-2Kriegm Kriegref="http://de.wikiactu.com741"m+xml" tGa80imağuva">Gazimağuvarna>">/" e<' />> Gamal Mubarakrna>">/" e<' />222ale-inem-2Kriegsverbree-enm Kriegsverbree-enhref="http://de.wikiactu.com3655"m+xml" t784re Roger">Frère Rogerrna>">/" e<' />> 784re-inem-2Krim-Kongo-Fiebir-4Krim-Kongo-Fiebirref="http://de.wikiactu.com741"m+xml" tGa959a (Stadt)">Gaza (Stadt)rna>">/" e<' />> 959be-inem-2Kriminalfall vne Amstettenm Kriminalfall vne Amstettenhref="http://de.wikiactu.com4871ym+xml" t672ball allg.">Fußball allg.rna>">/" e<' /672ee-inem-2Kriminalistikm Kriminalistikref="http://de.wikiactu.com741"m+xml" tGa58bisbre Politik">Gambisbre Politikrna>">/587ee-inem-2Kriminalstatistikm Kriminalstatistikhref="http://de.wikiactu.com2473"m+xml" t448ermittelhersteller">Futtermittelherstel448ee-inem-2Kriminelle Vereinigung lKriminelle Vereinigungref="http://de.wikiactu.com741"m+xml" tGa848ermittelhersteller">Futtermittelherstel848ee-inem-2Kriminologie-4Kriminologiehref="http://de.wikiactu.com3655"m+xml" t36xeries Lafayette"tGaleries Lafayetterna>"36xere-inem-2Krisenregion Südthailandm Krisenregion Südthailandhref="http://de.wikiactu.com3655"m+xml" t3162pagosinseln">Galapagosinselnrna>">/" e<3162pe-inem-2Kristendemokraternem Kristendemokraternehref="http://de.wikiactu.com4871ym+xml" t6502pagosinseln">Galapagosinselnrna>">/" e<6502pe-inem-2Kristina Sinröderm Kristina Sinröderhref="http://de.wikiactu.com4871ym+xml" t6335isbre Politik">Gambisbre Politikrna>">/6335ie-inem-2Kroatienm Kroatienref="http://de.wikiactu.com741"m+xml" tGa50re Roger">Frère Rogerrna>">/" e<' />> 50re-inem-2Kroatisyti Fußballnationalman sytaft-4Kroatisyti Fußballnationalman sytafthref="http://de.wikiactu.com4871ym+xml" t6700n Politik">Gabun Politikrna>">/" e<' />6700ne-inem-2Kromolin Stary-4Kromolin Staryref="http://de.wikiactu.com741"m+xml" tGa83xileo Galilei">Galileo Galileirna>">/" e<831ile-inem-2Kronaum Kronauhref="http://de.wikiactu.com2473"m+xml" t333al Mubarak">Gamal Mubarakrna>">/" e<' />333ale-inem-2Kronprinzessin Mary-4Kronprinzessin Maryref="http://de.wikiactu.com741"m+xml" tGa80ermittelhersteller">Futtermittelherstel80ee-inem-2Kropp-4Kroppref="http://de.wikiactu.com741"m+xml" tGa537bisbre Politik">Gambisbre Politikrna>">/537bie-inem-2Kröte-4Kröteref="http://de.wikiactu.com741"m+xml" tGa178ermittelhersteller">Futtermittelherstel178bae-inem-2Krünm Krünhref="http://de.wikiactu.com2473"m+xml" t444al Mubarak">Gamal Mubarakrna>">/" e<' />4443ie-inem-2KSE-Vertrag lKSE-Vertragref="http://de.wikiactu.com741"m+xml" tGa93b2pagosinseln">Galapagosinselnrna>">/" e<93bbre-inem-2KSLV lKSLVref="http://de.wikiactu.com741"m+xml" tGa562iburg im Üechtland">Freiburg im Üechtl562ibe-inem-2KTM-4KTMhref="http://de.wikiactu.com3655"m+xml" t841bisbre Politik">Gambisbre Politikrna>">/841bie-inem-2Ku Klux Klan-4Ku Klux Klanhref="http://de.wikiactu.com4871ym+xml" t635isbre Politik">Gambisbre Politikrna>">/635ie-inem-2Kuala Lumpurm Kuala Lumpurref="http://de.wikiactu.com741"m+xml" tGa893al Mubarak">Gamal Mubarakrna>">/" e<' />893ale-inem-2Kubanisytis Militärwesa m Kubanisytis Militärwesa ref="http://de.wikiactu.com741"m+xml" tGa142ball-Bundesliga dt. allg.">Fußball-Bun142be-inem-2Kufsteinm Kufsteinref="http://de.wikiactu.com741"m+xml" tGa890ball-2.Bundesliga dt. (Spielbericht)ytF890be-inem-2Kugelstoßa m Kugelstoßa href="http://de.wikiactu.com4871ym+xml" t61bal Mubarak">Gamal Mubarakrna>">/" e<' />61bale-inem-2Kulam Kulahref="http://de.wikiactu.com4871ym+xml" t6673ball-Weltmeivtersbraft der Frauen 2011y6673be-inem-2Kultur im Iran-4Kultur im Iranhref="http://de.wikiactu.com4871ym+xml" t190dez">Gardezrna>">/" e<' />>
Galapagosinselnrna>">/" e<8920ye-inem-2Kultur im Westjordanlandm Kultur im Westjordanlandhref="http://de.wikiactu.com3655"m+xml" t732bisbre Politik">Gambisbre Politikrna>">/732bie-inem-2Kultur in Ägyptenm Kultur in Ägyptenhref="http://de.wikiactu.com3655"m+xml" t74x2pagosinseln">Galapagosinselnrna>">/" e<74x2pe-inem-2Kultur in Algerienm Kultur in Algerienref="http://de.wikiactu.com741"m+xml" tGa5268ball-2.Bundesliga dt. (Spielbericht)ytF52ztwe-inem-2Kultur in Australienm Kultur in Australienhref="http://de.wikiactu.com4871ym+xml" tG60ball-2.Bundesliga dt. (Spielbericht)ytF460ile-inem-2Kultur in Chinam Kultur in Chinahref="http://de.wikiactu.com3655"m+xml" t723al Mubarak">Gamal Mubarakrna>">/" e<' />7233be-inem-2Kultur in den Niederlandenm Kultur in den Niederlandenhref="http://de.wikiactu.com4871ym+xml" t132ileo Galilei">Galileo Galileirna>">/" e<132ile-inem-2Kultur in den Vereinigten Staatenm Kultur in den Vereinigten Staatenhref="http://de.wikiactu.com4871ym+xml" tG06al Mubarak">Gamal Mubarakrna>">/" e<' />4063be-inem-2Kultur in der Sinweizm Kultur in der Sinweizhref="http://de.wikiactu.com3655"m+xml" t8440n Politik">Gabun Politikrna>">/" e<' />8440ne-inem-2Kultur in der Türkeim Kultur in der Türkeiref="http://de.wikiactu.com741"m+xml" tGa144al Mubarak">Gamal Mubarakrna>">/" e<' />1443ie-inem-2Kultur in Deutsm landm Kultur in Deutsm landhref="http://de.wikiactu.com3655"m+xml" t367ileo Galilei">Galileo Galileirna>">/" e<367ile-inem-2Kultur in Estlandm Kultur in Estlandhref="http://de.wikiactu.com3655"m+xml" t373ball allg.">Fußball allg.rna>">/" e<' /373bae-inem-2Kultur in Europam Kultur in Europaref="http://de.wikiactu.com741"m+xml" tGa596un Politik">Gabun Politikrna>">/" e<' />596une-inem-2Kultur in Frankreich-4Kultur in Frankreichhref="http://de.wikiactu.com4871ym+xml" t618dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />778une-inem-2Kultur in Indonesienm Kultur in Indonesienref="http://de.wikiactu.com741"m+xml" tGa173al Mubarak">Gamal Mubarakrna>">/" e<' />1733be-inem-2Kultur in Italienm Kultur in Italienhref="http://de.wikiactu.com2473"m+xml" t443un Politik">Gabun Politikrna>">/" e<' />443une-inem-2Kultur in Japanm Kultur in Japanhref="http://de.wikiactu.com4871ym+xml" t652un Politik">Gabun Politikrna>">/" e<' />652une-inem-2Kultur in Müne-enm Kultur in Müne-enhref="http://de.wikiactu.com4871ym+xml" t6410n Politik">Gabun Politikrna>">/" e<' />6410ne-inem-2Kultur in Norwegenm Kultur in Norwegenref="http://de.wikiactu.com741"m+xml" tGa102al Mubarak">Gamal Mubarakrna>">/" e<' />1023be-inem-2Kultur in Österreichm Kultur in Österreichhref="http://de.wikiactu.com4871ym+xml" t87bball-Bundesliga dt. allg.">Fußball-Bun87bbe-inem-2Kultur in Paraguaym Kultur in Paraguayhref="http://de.wikiactu.com3655"m+xml" t753ermittelhersteller">Futtermittelherstel753bae-inem-2Kultur in Polenm Kultur in Polenhref="http://de.wikiactu.com3655"m+xml" t77ermittelhersteller">Futtermittelherstel77ee-inem-2Kultur in Saudi-Arabienm Kultur in Saudi-Arabienhref="http://de.wikiactu.com4871ym+xml" t8655wangenytFurtwangenrna>">/" e<' />> "94ere-inem-2Kultur in Tsytichienm Kultur in Tsytichienhref="http://de.wikiactu.com4871ym+xml" tG69al Mubarak">Gamal Mubarakrna>">/" e<' />4693be-inem-2Kulturdenkmalm Kulturdenkmalref="http://de.wikiactu.com741"m+xml" tGa16xeries Lafayette"tGaleries Lafayetterna>"16xere-inem-2Kultureventm Kultureventref="http://de.wikiactu.com741"m+xml" tGa14bbisbre Politik">Gambisbre Politikrna>">/145bie-inem-2Kulturpolitik-4Kulturpolitikref="http://de.wikiactu.com741"m+xml" tGa5510n Politik">Gabun Politikrna>">/" e<' />5510ne-inem-2Kultursendung lKultursendunghref="http://de.wikiactu.com4871ym+xml" t130ball-2.Bundesliga dt. (Spielbericht)ytF130be-inem-2Kultusministerkonfera zm Kultusministerkonfera zhref="http://de.wikiactu.com4871ym+xml" tG23un Politik">Gabun Politikrna>">/" e<' />423une-inem-2Kundensytädigung lKundensytädigunghref="http://de.wikiactu.com2473"m+xml" t3390n Politik">Gabun Politikrna>">/" e<' />3390ne-inem-2Kundgebung lKundgebunghref="http://de.wikiactu.com5350y>+xml" t246ileo Galilei">Galileo Galileirna>">/" e<246ile-inem-2Kündigungsre-utz lKündigungsre-utzref="http://de.wikiactu.com741"m+xml" tGa57ermittelhersteller">Futtermittelherstel57ee-inem-2Kundus lKundushref="http://de.wikiactu.com3655"m+xml" t36xre Roger">Frère Rogerrna>">/" e<' />> 361bie-inem-2Kunitachi-4Kunitachihref="http://de.wikiactu.com4871ym+xml" t658al Mubarak">Gamal Mubarakrna>">/" e<' />658ale-inem-2Kunst-4Kunstref="http://de.wikiactu.com741"m+xml" tGa100ball-Bundesliga dt. allg.">Fußball-Bun100be-inem-2Kunstausstellung lKunstausstellungref="http://de.wikiactu.com741"m+xml" tGa51bball-Bundesliga dt. allg.">Fußball-Bun51bbe-inem-2Kunstmarkt-4Kunstmarkthref="http://de.wikiactu.com3655"m+xml" t7738ball-2.Bundesliga dt. (Spielbericht)ytF7738be-inem-2Kuopio-4Kuopioref="http://de.wikiactu.com741"m+xml" tGa156al Mubarak">Gamal Mubarakrna>">/" e<' />156ale-inem-2Kupang lKupanghref="http://de.wikiactu.com4871ym+xml" t667bring b.Münbren">Garbring b.Münbrenrna66rbe-inem-2Kurden lKurdenhref="http://de.wikiactu.com4871ym+xml" t4rtwangenytFurtwangenrna>">/" e<' />> Gabun Politikrna>">/" e<' />624unv clre-iKurt Biedenkopf-4Kurt Biedenkopfhref="http://de.wikiactu.com5350y>+xml" t247bisbre Politik">Gambisbre Politikrna>">/247biv clre-iKurt Grünewaldm Kurt Grünewaldref="http://de.wikiactu.com741"m+xml" tGa988al Mubarak">Gamal Mubarakrna>">/" e<' />988alv clre-iKurt Masurm Kurt Masurhref="http://de.wikiactu.com2473"m+xml" t48ßball-2.Bundesliga dt. (Spielbericht)ytF48ßbv clre-iKurt Neuman -4Kurt Neuman href="http://de.wikiactu.com3655"m+xml" t374re Roger">Frère Rogerrna>">/" e<' />> 374biv clre-iKurt Rebman -4Kurt Rebman href="http://de.wikiactu.com3655"m+xml" t756bisbre Politik">Gambisbre Politikrna>">/75zbie-inem-2Kurt Tucholsky-4Kurt Tucholskyref="http://de.wikiactu.com741"m+xml" tGa15imağuva">Gazimağuvarna>">/" e<' />> Freiburg im Üechtl6982wv clre-iKurt Westergaardm Kurt Westergaardref="http://de.wikiactu.com741"m+xml" tGa10ßball-2.Bundesliga dt. (Spielbericht)ytF10ßbv clre-iKuşadasım Kuşadasıref="http://de.wikiactu.com741"m+xml" tGa910imağuva">Gazimağuvarna>">/" e<' />> Gamal Mubarakrna>">/" e<' />58ale-inem-2Kutam Kutaref="http://de.wikiactu.com741"m+xml" tGa554edrich II. (Preußen)ytFriedrich II. (Pr554ede-inem-2Kuusamo-4Kuusamohref="http://de.wikiactu.com5350y>+xml" t2520n Politik">Gabun Politikrna>">/" e<' />2520ne-inem-2Kuwait-Stadt-4Kuwait-Stadthref="http://de.wikiactu.com4871ym+xml" t811ermittelhersteller">Futtermittelherstel811ee-inem-2Kuwaitisyti Politik-4Kuwaitisyti Politikhref="http://de.wikiactu.com4871ym+xml" t863ermittelhersteller">Futtermittelherstel863ee-inem-2KVC Westerlo-4KVC Westerlohref="http://de.wikiactu.com2473"m+xml" t4320ytG-20rna>">/" e<' />>
Gabun Politikrna>">/" e<' />4420ne-inem-2Kwame Nkrumahm Kwame Nkrumahhref="http://de.wikiactu.com3655"m+xml" t357un Politik">Gabun Politikrna>">/" e<' />3571ae-inem-2Kyōto-4Kyōtoref="http://de.wikiactu.com741"m+xml" tGa924edrich II. (Preußen)ytFriedrich II. (Pr924ede-inem-2Kyūshū-4Kyūshūhref="http://de.wikiactu.com2473"m+xml" t492dez">Gardezrna>">/" e<' />>
La Digueref="http://de.wikiactu.com741"m+xml" tGa168twangenytFurtwangenrna>">/" e<' />> Gambisbre Politikrna>">/G2bbie-inem-2Laax-4Laaxref="http://de.wikiactu.com741"m+xml" tGa518twangenytFurtwangenrna>">/" e<' />> Futtermittelherstel798ee-inem-2Lac-Mégantic-4Lac-Méganticref="http://de.wikiactu.com741"m+xml" tGa900n Politik">Gabun Politikrna>">/" e<' />900ne-inem-2Lacrosse">Lacrossehref="http://de.wikiactu.com3655"m+xml" t763un Politik">Gabun Politikrna>">/" e<' />7631rv clre-iLadensytlussgesetz lLadensytlussgesetzhref="http://de.wikiactu.com3655"m+xml" t3400n Politik">Gabun Politikrna>">/" e<' />3400nv clre-iLadislav Anisic-4Ladislav Anisicref="http://de.wikiactu.com741"m+xml" tGa54imağuva">Gazimağuvarna>">/" e<' />> Fußball-Bun746bv clre-iLaerm Laerref="http://de.wikiactu.com741"m+xml" tGa950ball-Bundesliga dt. allg.">Fußball-Bun950bv clre-iLaFayette (Georgia)-4LaFayette (Georgia)ref="http://de.wikiactu.com741"m+xml" tGa166ball-2.Bundesliga dt. (Spielbericht)ytF166ile-inem-2Lagos-4Lagoshref="http://de.wikiactu.com5350y>+xml" t256al Mubarak">Gamal Mubarakrna>">/" e<' />256ale-inem-2LaGuardia Airport (New York)-4LaGuardia Airport (New York)ref="http://de.wikiactu.com741"m+xml" tGa83x2pagosinseln">Galapagosinselnrna>">/" e<8320ye-inem-2Laguiole">Laguiolehref="http://de.wikiactu.com5350y>+xml" t220un Politik">Gabun Politikrna>">/" e<' />220unv clre-iLähmung lLähmunghref="http://de.wikiactu.com4871ym+xml" t628twangenytFurtwangenrna>">/" e<' />> Lahorehref="http://de.wikiactu.com4871ym+xml" t8138ball-2.Bundesliga dt. (Spielbericht)ytF8138be-inem-2Laichingenm Laichingenhref="http://de.wikiactu.com4871ym+xml" t640n Politik">Gabun Politikrna>">/" e<' />640nv clre-iLaisenia Qarase">Laisenia Qarasehref="http://de.wikiactu.com4871ym+xml" t6120n Politik">Gabun Politikrna>">/" e<' />6120nv clre-iLaizismus-4Laizismusref="http://de.wikiactu.com741"m+xml" tGa173ermittelhersteller">Futtermittelherstel173ee-inem-2Laki George (New York)-4Laki George (New York)href="http://de.wikiactu.com3655"m+xml" t705nk-Jürgen Weise">Frank-Jürgen Weiserna705nke-inem-2Lakhnaum Lakhnauhref="http://de.wikiactu.com3655"m+xml" t3402pagosinseln">Galapagosinselnrna>">/" e<3400ye-inem-2Lakaelvm Lakaelvref="http://de.wikiactu.com741"m+xml" tGa92zbisbre Politik">Gambisbre Politikrna>">/9267ye-inem-2Lakahman Kadirgamarm Lakahman Kadirgamarhref="http://de.wikiactu.com3655"m+xml" t782dez">Gardezrna>">/" e<' />>
Lambarenehref="http://de.wikiactu.com3655"m+xml" t78rballtrainer">Fußballtrainerrna>">/" e<78rbe-inem-2Lamborghini">Lamborghinihref="http://de.wikiactu.com3655"m+xml" t744un Politik">Gabun Politikrna>">/" e<' />744une-inem-2Lamine Diack-4Lamine Diackhref="http://de.wikiactu.com4871ym+xml" t813ball-2.Bundesliga dt. (Spielbericht)ytF813ile-inem-2Lampedusa e Linosa-4Lampedusa e Linosahref="http://de.wikiactu.com3655"m+xml" t7902pagosinseln">Galapagosinselnrna>">/" e<7900ye-inem-2Lana Turnerm Lana Turnerhref="http://de.wikiactu.com5350y>+xml" t28bball-Bundesliga dt. allg.">Fußball-Bun28bbe-inem-2Lance Armstrong lLance Armstronghref="http://de.wikiactu.com4871ym+xml" tG690ytG-20rna>">/" e<' />>
Fußball-Bun310be-inem-2Landeree-tm Landeree-thref="http://de.wikiactu.com5350y>+xml" t232ileo Galilei">Galileo Galileirna>">/" e<232ile-inem-2Länderspiel lLänderspielref="http://de.wikiactu.com741"m+xml" tGa557dez">Gardezrna>">/" e<' />>
Galileo Galileirna>">/" e<642ile-inem-2Landfriedensbruyt lLandfriedensbruytref="http://de.wikiactu.com741"m+xml" tGa594ileo Galilei">Galileo Galileirna>">/" e<594ile-inem-2Landgerie-t Aae-enm Landgerie-t Aae-enref="http://de.wikiactu.com741"m+xml" tGa90r0n Politik">Gabun Politikrna>">/" e<' />90r0ne-inem-2Landgerie-t Amberg lLandgerie-t Amberghref="http://de.wikiactu.com3655"m+xml" t37bbisbre Politik">Gambisbre Politikrna>">/37bbie-inem-2Landgerie-t Augsburg-4Landgerie-t Augsburgref="http://de.wikiactu.com741"m+xml" tGa1138ball-2.Bundesliga dt. (Spielbericht)ytF1138be-inem-2Landgerie-t Berlinm Landgerie-t Berlinhref="http://de.wikiactu.com3655"m+xml" t58adez">Gardezrna>">/" e<' />>
Galapagosinselnrna>">/" e<3300ye-inem-2Landgerie-t Bochumm Landgerie-t Bochumhref="http://de.wikiactu.com2473"m+xml" t43bball-Bundesliga dt. allg.">Fußball-Bun43bbe-inem-2Landgerie-t Bonnm Landgerie-t Bon href="http://de.wikiactu.com3655"m+xml" t505nk-Jürgen Weise">Frank-Jürgen Weiserna505nke-inem-2Landgerie-t Bremenm Landgerie-t Bremenhref="http://de.wikiactu.com3655"m+xml" t792un Politik">Gabun Politikrna>">/" e<' />792une-inem-2Landgerie-t Chemnitzm Landgerie-t Chemnitzhref="http://de.wikiactu.com3655"m+xml" t718ermittelhersteller">Futtermittelherstel718ee-inem-2Landgerie-t Coburg-4Landgerie-t Coburghref="http://de.wikiactu.com3655"m+xml" t840al Mubarak">Gamal Mubarakrna>">/" e<' />840ale-inem-2Landgerie-t Cottbus-4Landgerie-t Cottbushref="http://de.wikiactu.com4871ym+xml" t653al Mubarak">Gamal Mubarakrna>">/" e<' />653ale-inem-2Landgerie-t Darmstadt-4Landgerie-t Darmstadtref="http://de.wikiactu.com741"m+xml" tGa1130ytG-20rna>">/" e<' />>
Gazimağuvarna>">/" e<' />> Futtermittelherstel41ee-inem-2Landgerie-t Düsaeldorf-4Landgerie-t Düsaeldorfref="http://de.wikiactu.com741"m+xml" tGa95imağuva">Gazimağuvarna>">/" e<' />> Fußball-Bun26bbe-inem-2Landgerie-t Frankfurt a. M.m Landgerie-t Frankfurt a. M.href="http://de.wikiactu.com2473"m+xml" t444un Politik">Gabun Politikrna>">/" e<' />444une-inem-2Landgerie-t Hagenm Landgerie-t Hagenref="http://de.wikiactu.com741"m+xml" tGa3362pagosinseln">Galapagosinselnrna>">/" e<3362p e<' />>Landgerie-t Hamburg-4Landgerie-t Hamburghref="http://de.wikiactu.com4871ym+xml" t648al Mubarak">Gamal Mubarakrna>">/" e<' />648ale-inem-2Landgerie-t Hannoverm Landgerie-t Hannoverhref="http://de.wikiactu.com3655"m+xml" t887bisbre Politik">Gambisbre Politikrna>">/887bi e<' />>Landgerie-t Heilbronnm Landgerie-t Heilbronnhref="http://de.wikiactu.com3655"m+xml" t7255wangenytFurtwangenrna>">/" e<' />> >Landgerie-t Itzehoem Landgerie-t Itzehoehref="http://de.wikiactu.com3655"m+xml" t796bisbre Politik">Gambisbre Politikrna>">/796bi e<' />>Landgerie-t Kaiserslautern lLandgerie-t Kaiserslauternhref="http://de.wikiactu.com5350y>+xml" t26bdez">Gardezrna>">/" e<' />>
>Landgerie-t Kasael-4Landgerie-t Kasaelref="http://de.wikiactu.com741"m+xml" tGa832al Mubarak">Gamal Mubarakrna>">/" e<' />832al e<' />>Landgerie-t Kempten (Allgäu)-4Landgerie-t Kempten (Allgäu)ref="http://de.wikiactu.com741"m+xml" tGa983un Politik">Gabun Politikrna>">/" e<' />983une-inem-2Landgerie-t Kiel-4Landgerie-t Kielref="http://de.wikiactu.com741"m+xml" tGa6855wangenytFurtwangenrna>">/" e<' />> Gamal Mubarakrna>">/" e<' />810ale-inem-2Landgerie-t Landshut-4Landgerie-t Landshutref="http://de.wikiactu.com741"m+xml" tGa328ball-Bundesliga dt. allg.">Fußball-Bun328be-inem-2Landgerie-t Leipzig-4Landgerie-t Leipzighref="http://de.wikiactu.com3655"m+xml" t754twangenytFurtwangenrna>">/" e<' />> Frank-Jürgen Weiserna625nke-inem-2Landgerie-t Mannheim-4Landgerie-t Mannheimref="http://de.wikiactu.com741"m+xml" tGa309al Mubarak">Gamal Mubarakrna>">/" e<' />309ale-inem-2Landgerie-t Meiningenm Landgerie-t Meiningenhref="http://de.wikiactu.com4871ym+xml" t600bisbre Politik">Gambisbre Politikrna>">/600bie-inem-2Landgerie-t Möne-engladbayt lLandgerie-t Möne-engladbaythref="http://de.wikiactu.com4871ym+xml" t4r0imağuva">Gazimağuvarna>">/" e<' />> Gabun Politikrna>">/" e<' />38une-inem-2Landgerie-t Müne-enm Landgerie-t Müne-enref="http://de.wikiactu.com741"m+xml" tGa537ermittelhersteller">Futtermittelherstel537ee-inem-2Landgerie-t Münsterm Landgerie-t Münsterref="http://de.wikiactu.com741"m+xml" tGa32bdez">Gardezrna>">/" e<' />>
"814dee-inem-2Landgerie-t Oldenburg-4Landgerie-t Oldenburghref="http://de.wikiactu.com3655"m+xml" t5020ytG-20rna>">/" e<' />>
>Landgerie-t Osnabrück-4Landgerie-t Osnabrückref="http://de.wikiactu.com741"m+xml" tGa955imağuva">Gazimağuvarna>">/" e<' />> >Landgerie-t Rostock-4Landgerie-t Rostockhref="http://de.wikiactu.com4871ym+xml" t826ball-Bundesliga dt. allg.">Fußball-Bun826b e<' />>Landgerie-t Stadem Landgerie-t Stadehref="http://de.wikiactu.com3655"m+xml" t847bisbre Politik">Gambisbre Politikrna>">/847bi e<' />>Landgerie-t Stralsundm Landgerie-t Stralsundhref="http://de.wikiactu.com5350y>+xml" t29al Mubarak">Gamal Mubarakrna>">/" e<' />29ale-inem-2Landgerie-t Stuttgartm Landgerie-t Stuttgarthref="http://de.wikiactu.com2473"m+xml" t447bring b.Münbren">Garbring b.Münbrenrna447bre-inem-2Landgerie-t Trierm Landgerie-t Trierhref="http://de.wikiactu.com3655"m+xml" t840un Politik">Gabun Politikrna>">/" e<' />840une-inem-2Landgerie-t Verden an der Aller-4Landgerie-t Verden an der Allerref="http://de.wikiactu.com741"m+xml" tGa962balltrainer">Fußballtrainerrna>">/" e<962be-inem-2Landgerie-t Wiesbadenm Landgerie-t Wiesbadenhref="http://de.wikiactu.com4871ym+xml" t626al Mubarak">Gamal Mubarakrna>">/" e<' />626ale-inem-2Landgerie-t Wuppertalm Landgerie-t Wuppertalref="http://de.wikiactu.com741"m+xml" tGa386ball-2.Bundesliga dt. (Spielbericht)ytF386be-inem-2Landkreis Kaiserslautern lLandkreis Kaiserslauternhref="http://de.wikiactu.com2473"m+xml" t478twangenytFurtwangenrna>">/" e<' />> Gardezrna>">/" e<' />>
Futtermittelherstel469ee-inem-2Landshut-4Landshutref="http://de.wikiactu.com741"m+xml" tGa14re Roger">Frère Rogerrna>">/" e<' />> 14bi e<' />>Landwirtsm aft-4Landwirtsm afthref="http://de.wikiactu.com3655"m+xml" t752al Mubarak">Gamal Mubarakrna>">/" e<' />752al e<' />>Landwirtsm aft Ökologisyt lLandwirtsm aft Ökologisytref="http://de.wikiactu.com741"m+xml" tGa947un Politik">Gabun Politikrna>">/" e<' />947un e<' />>Langelsheim-4Langelsheimhref="http://de.wikiactu.com2473"m+xml" t447ermittelhersteller">Futtermittelherstel447ee-inem-2Langenselboldm Langenselboldhref="http://de.wikiactu.com3655"m+xml" t802pagosinseln">Galapagosinselnrna>">/" e<800ye-inem-2Langer Marsyt lLanger Marsythref="http://de.wikiactu.com3655"m+xml" t7168ball-2.Bundesliga dt. (Spielbericht)ytF7168be-inem-2Langfang lLangfanghref="http://de.wikiactu.com2473"m+xml" t492bisbre Politik">Gambisbre Politikrna>">/G92bi e<' />>Langkawi lLangkawihref="http://de.wikiactu.com5350y>+xml" t21xileo Galilei">Galileo Galileirna>">/" e<21xil e<' />>Langley (Virginia)-4Langley (Virginia)href="http://de.wikiactu.com3655"m+xml" t356dez">Gardezrna>">/" e<' />>
Gardezrna>">/" e<' />>
Fußball-Bun93bbe-inem-2LAPAN-TUSAT-4LAPAN-TUSATref="http://de.wikiactu.com741"m+xml" tGa537nk-Jürgen Weise">Frank-Jürgen Weiserna53r0ne-inem-2Large Hadron Collider-4Large Hadron Colliderref="http://de.wikiactu.com741"m+xml" tGa595imağuva">Gazimağuvarna>">/" e<' />> "1196pe-inem-2Lärmre-utz lLärmre-utzhref="http://de.wikiactu.com3655"m+xml" t394ball allg.">Fußball allg.rna>">/" e<' /394bae-inem-2Larnaka-4Larnakaref="http://de.wikiactu.com741"m+xml" tGa975imağuva">Gazimağuvarna>">/" e<' />> >Larry Sanger-4Larry Sangerhref="http://de.wikiactu.com3655"m+xml" t8ermittelhersteller">Futtermittelherstel85bae-inem-2Lars Göran Josefsson lLars Göran Josefssonhref="http://de.wikiactu.com3655"m+xml" t31eries Lafayette"tGaleries Lafayetterna>"31ere-inem-2Lars Ulriyt lLars Ulriythref="http://de.wikiactu.com3655"m+xml" t712pagosinseln">Galapagosinselnrna>">/" e<712p e<' />>Las Cruces-4Las Cruceshref="http://de.wikiactu.com5350y>+xml" t252ileo Galilei">Galileo Galileirna>">/" e<252ile-inem-2Las Cruces International Airport-4Las Cruces International Airportref="http://de.wikiactu.com741"m+xml" tGa90ileo Galilei">Galileo Galileirna>">/" e<90be-inem-2Las Vegas-4Las Vegashref="http://de.wikiactu.com5350y>+xml" t256imağuva">Gazimağuvarna>">/" e<' />> Frère Rogerrna>">/" e<' />> 4rre-inem-2Lassafiebir-4Lassafiebirref="http://de.wikiactu.com741"m+xml" tGa154ileo Galilei">Galileo Galileirna>">/" e<154ile-inem-2Lat-enm Lat-enhref="http://de.wikiactu.com3655"m+xml" t7668ball-2.Bundesliga dt. (Spielbericht)ytF7668be-inem-2Lauenburg/Elbem Lauenburg/Elberef="http://de.wikiactu.com741"m+xml" tGa950edrich II. (Preußen)ytFriedrich II. (Pr9500ye-inem-2Laufeldm Laufeldhref="http://de.wikiactu.com2473"m+xml" t911al Mubarak">Gamal Mubarakrna>">/" e<' />911ale-inem-2Laufersweiler-4Laufersweilerhref="http://de.wikiactu.com3655"m+xml" t505ermittelhersteller">Futtermittelherstel505bae-inem-2Laupheim-4Laupheimhref="http://de.wikiactu.com4871ym+xml" t605ileo Galilei">Galileo Galileirna>">/" e<605ile-inem-2Laura Chinchilla-4Laura Chinchillahref="http://de.wikiactu.com3655"m+xml" t342iburg im Üechtland">Freiburg im Üechtl342ibe-inem-2Laurent Gbagbo-4Laurent Gbagbohref="http://de.wikiactu.com4871ym+xml" t48iburg im Üechtland">Freiburg im Üechtl48ibe-inem-2Laurenz Meyer-4Laurenz Meyerref="http://de.wikiactu.com741"m+xml" tGa938al Mubarak">Gamal Mubarakrna>">/" e<' />938ale-inem-2Lauro Baya-4Lauro Bayahref="http://de.wikiactu.com5350y>+xml" t2390n Politik">Gabun Politikrna>">/" e<' />2390ne-inem-2Lausanne">Lausannehref="http://de.wikiactu.com3655"m+xml" t528al Mubarak">Gamal Mubarakrna>">/" e<' />528ale-inem-2Lautém (Distrikt)-4Lautém (Distrikt)href="http://de.wikiactu.com3655"m+xml" t713al Mubarak">Gamal Mubarakrna>">/" e<' />713ale-inem-2Lauterbourg-4Lauterbourghref="http://de.wikiactu.com5350y>+xml" t202ball allg.">Fußball allg.rna>">/" e<' /202bae-inem-2Lauterbrunnen-4Lauterbrunnenref="http://de.wikiactu.com741"m+xml" tGa138iburg im Üechtland">Freiburg im Üechtl138ibe-inem-2Lautzenhausen-4Lautzenhausenref="http://de.wikiactu.com741"m+xml" tGa105nk-Jürgen Weise">Frank-Jürgen Weiserna105nke-inem-2Laval (Québec)-4Laval (Québec)href="http://de.wikiactu.com2473"m+xml" t411al Mubarak">Gamal Mubarakrna>">/" e<' />411ale-inem-2LAVES-4LAVEShref="http://de.wikiactu.com4871ym+xml" t4r3un Politik">Gabun Politikrna>">/" e<' />453une-inem-2Lazardm Lazardhref="http://de.wikiactu.com2473"m+xml" t418ball-2.Bundesliga dt. (Spielbericht)ytF418be-inem-2LDPm LDPhref="http://de.wikiactu.com3655"m+xml" t74ball-2.Bundesliga dt. (Spielbericht)ytF74ile-inem-2LDREX-2m LDREX-2href="http://de.wikiactu.com3655"m+xml" t8430n Politik">Gabun Politikrna>">/" e<' />843nke-inem-2Le Bourget-4Le Bourgetref="http://de.wikiactu.com741"m+xml" tGa935ileo Galilei">Galileo Galileirna>">/" e<935ile-inem-2Le Puy-en-Velaym Le Puy-en-Velayref="http://de.wikiactu.com741"m+xml" tGa9760n Politik">Gabun Politikrna>">/" e<' />9760ne-inem-2LeadAwards-4LeadAwardshref="http://de.wikiactu.com3655"m+xml" t738ball-Bundesliga dt. allg.">Fußball-Bun738be-inem-2Leafieldm Leafieldhref="http://de.wikiactu.com2473"m+xml" t4230n Politik">Gabun Politikrna>">/" e<' />4230ne-inem-2Lebensmittelgesetz lLebensmittelgesetzhref="http://de.wikiactu.com3655"m+xml" t7610n Politik">Gabun Politikrna>">/" e<' />7610ne-inem-2Lebensmittelhersteller-4Lebensmittelherstellerref="http://de.wikiactu.com741"m+xml" tGa140ball-2.Bundesliga dt. (Spielbericht)ytF140be-inem-2Lebensstandardm Lebensstandardref="http://de.wikiactu.com741"m+xml" tGa136ball-Bundesliga dt. allg.">Fußball-Bun136be-inem-2Lech Kaczyński lLech Kaczyńskiref="http://de.wikiactu.com741"m+xml" tGa9911n Politik">Gabun Politikrna>">/" e<' />9911ne-inem-2Lech Wałęsa-4Lech Wałęsahref="http://de.wikiactu.com3655"m+xml" t79ermittelhersteller">Futtermittelherstel79bae-inem-2Lee Taesik-4Lee Taesikref="http://de.wikiactu.com741"m+xml" tGa168termittelhersteller">Futtermittelherstel168tee-inem-2Leeds-4Leedshref="http://de.wikiactu.com3655"m+xml" t7800n Politik">Gabun Politikrna>">/" e<' />7800ne-inem-2Leelavati-Preis-4Leelavati-Preisref="http://de.wikiactu.com741"m+xml" tGa594al Mubarak">Gamal Mubarakrna>">/" e<' />5943ie-inem-2Leer-4Leerref="http://de.wikiactu.com741"m+xml" tGa974re Roger">Frère Rogerrna>">/" e<' />> 974biv clre-iLeeuwarden-4Leeuwardenhref="http://de.wikiactu.com2473"m+xml" t474ball-2.Bundesliga dt. (Spielbericht)ytF474ile-inem-2Lega Nordm Lega Nordhref="http://de.wikiactu.com3655"m+xml" t884eries Lafayette"tGaleries Lafayetterna>"884dee-inem-2Let lLethref="http://de.wikiactu.com3655"m+xml" t130ball-Bundesliga dt. allg.">Fußball-Bun130be-inem-2Lehman Brothers lLetman Brothersref="http://de.wikiactu.com741"m+xml" tGa96eries Lafayette"tGaleries Lafayetterna>"965dee-inem-2Letrberg lLetrbergref="http://de.wikiactu.com741"m+xml" tGa92bisbre Politik">Gambisbre Politikrna>">/927ee-inem-2Letrer-4Letrerhref="http://de.wikiactu.com2473"m+xml" t426ermittelhersteller">Futtermittelherstel4264ee-inem-2Letrte-4Letrteref="http://de.wikiactu.com741"m+xml" tGa16bbisbre Politik">Gambisbre Politikrna>">/16bbie-inem-2Leicesterm Leicesterhref="http://de.wikiactu.com5350y>+xml" t28iburg im Üechtland">Freiburg im Üechtl28ibe-inem-2Leichenfundm Leichenfundhref="http://de.wikiactu.com5350y>+xml" t27eries Lafayette"tGaleries Lafayetterna>"27ere-inem-2Leichtathlet-4Leichtathlethref="http://de.wikiactu.com3655"m+xml" t505ileo Galilei">Galileo Galileirna>">/" e<505ile-inem-2Leichtathletik-4Leichtathletikhref="http://de.wikiactu.com5350y>+xml" t27ball-Bundesliga dt. allg.">Fußball-Bun2755we-inem-2Leichtatlethik-WM 200baLeichtatlethik-WM 200href="http://de.wikiactu.com3655"m+xml" t560imağuva">Gazimağuvarna>">/" e<' />> Fußball-Bun226b e<' />>Leinefelde-Worbis-4Leinefelde-Worbishref="http://de.wikiactu.com3655"m+xml" t773bisbre Politik">Gambisbre Politikrna>">/773bi e<' />>Leinfelden-Echterdingenm Leinfelden-Echterdingenref="http://de.wikiactu.com741"m+xml" tGa198ball-Bundesliga dt. allg.">Fußball-Bun198b e<' />>Leipzig-4Leipzighref="http://de.wikiactu.com3655"m+xml" t5073ball-Weltmeivtersbraft der Frauen 2011y5073b e<' />>Lemgo-4Lemgohref="http://de.wikiactu.com3655"m+xml" t370un Politik">Gabun Politikrna>">/" e<' />370un e<' />>Leni Riefenstahlm Leni Riefenstahlhref="http://de.wikiactu.com3655"m+xml" t773ermittelhersteller">Futtermittelherstel773ee-inem-2Lenovo-4Lenovohref="http://de.wikiactu.com3655"m+xml" t8990n Politik">Gabun Politikrna>">/" e<' />8990ne-inem-2Leo Kiryt lLeo Kirythref="http://de.wikiactu.com3655"m+xml" t806al Mubarak">Gamal Mubarakrna>">/" e<' />8063be-inem-2Leobenm Leobenhref="http://de.wikiactu.com3655"m+xml" t318bisbre Politik">Gambisbre Politikrna>">/318bie-inem-2Leónm Leónhref="http://de.wikiactu.com3655"m+xml" t56xileo Galilei">Galileo Galileirna>">/" e<56xile-inem-2Leon Panetta-4Leon Panettahref="http://de.wikiactu.com3655"m+xml" t36ball-Bundesliga dt. allg.">Fußball-Bun36be-inem-2Leonardo DiCaprio-4Leonardo DiCapriohref="http://de.wikiactu.com5350y>+xml" t261ball-Bundesliga dt. allg.">Fußball-Bun261be-inem-2Leonid Kutsm ma-4Leonid Kutsm maref="http://de.wikiactu.com741"m+xml" tGa837nk-Jürgen Weise">Frank-Jürgen Weiserna83r0ne-inem-2Lepra-4Leprahref="http://de.wikiactu.com5350y>+xml" t2511n Politik">Gabun Politikrna>">/" e<' />2511ne-inem-2Les Essarts-4Les Essartshref="http://de.wikiactu.com2473"m+xml" t444twangenytFurtwangenrna>">/" e<' />> Futtermittelherstel721ee-inem-2Leslie Nielsen-4Leslie Nielsenhref="http://de.wikiactu.com4871ym+xml" t818un Politik">Gabun Politikrna>">/" e<' />818une-inem-2Lesotho-4Lesothohref="http://de.wikiactu.com3655"m+xml" t313un Politik">Gabun Politikrna>">/" e<' />313une-inem-2Lesung lLesungref="http://de.wikiactu.com741"m+xml" tGa1811n Politik">Gabun Politikrna>">/" e<' />1811ne-inem-2LET-4LETref="http://de.wikiactu.com741"m+xml" tGa45xeries Lafayette"tGaleries Lafayetterna>"45xere-inem-2Letizia Ortiz Rocasolano-4Letizia Ortiz Rocasolanoref="http://de.wikiactu.com741"m+xml" tGa3840n Politik">Gabun Politikrna>">/" e<' />3840ne-inem-2Leukämie-4Leukämiehref="http://de.wikiactu.com4871ym+xml" t670un Politik">Gabun Politikrna>">/" e<' />670un e<' />>Leuphana Universität Lüneburg-4Leuphana Universität Lüneburghref="http://de.wikiactu.com3655"m+xml" t5710n Politik">Gabun Politikrna>">/" e<' />5710ne-inem-2Leutenbayt (Würtl" berg)-4Leutenbayt (Würtl" berg)ref="http://de.wikiactu.com741"m+xml" tGa330ball-2.Bundesliga dt. (Spielbericht)ytF330be-inem-2Lev Cinemas-4Lev Cinemashref="http://de.wikiactu.com2473"m+xml" t44eries Lafayette"tGaleries Lafayetterna>"44ere-inem-2Levanger-4Levangerref="http://de.wikiactu.com741"m+xml" tGa12ieries Lafayette"tGaleries Lafayetterna>"129ere-inem-2Leverkusen-4Leverkusenhref="http://de.wikiactu.com3655"m+xml" t890ball-Bundesliga dt. allg.">Fußball-Bun890be-inem-2Levi Leipheimer-4Levi Leipheimerref="http://de.wikiactu.com741"m+xml" tGa907bisbre Politik">Gambisbre Politikrna>">/907bie-inem-2Levy Mwanawasa-4Levy Mwanawasaref="http://de.wikiactu.com741"m+xml" tGa9710n Politik">Gabun Politikrna>">/" e<' />9710ne-inem-2Lewan Gatsm etsm iladse">Lewan Gatsm etsm iladsehref="http://de.wikiactu.com5350y>+xml" t203bisbre Politik">Gambisbre Politikrna>">/203bie-inem-2Lewis Libbym Lewis Libbyhref="http://de.wikiactu.com4871ym+xml" t480bisbre Politik">Gambisbre Politikrna>">/480bie-inem-2Lewis Pughm Lewis Pughhref="http://de.wikiactu.com3655"m+xml" t344un Politik">Gabun Politikrna>">/" e<' />344une-inem-2Lexikon lLexikonhref="http://de.wikiactu.com3655"m+xml" t3960n Politik">Gabun Politikrna>">/" e<' />3960ne-inem-2Lexington (Kentucky) lLexington (Kentucky)href="http://de.wikiactu.com2473"m+xml" t491ermittelhersteller">Futtermittelherstel491ee-inem-2Lexington (Massachusetts) lLexington (Massachusetts)ref="http://de.wikiactu.com741"m+xml" tGa837un Politik">Gabun Politikrna>">/" e<' />837un e<' />>Leyte-4Leyteref="http://de.wikiactu.com741"m+xml" tGa44uball-2.Bundesliga dt. (Spielbericht)ytF44xile-inem-2Lézxmlsur-Lèze-4Lézxmlsur-Lèzehref="http://de.wikiactu.com3655"m+xml" t8852pagosinseln">Galapagosinselnrna>">/" e<8852pe-inem-2LfM-4LfMref="http://de.wikiactu.com741"m+xml" tGa598ball-Bundesliga dt. allg.">Fußball-Bun598b e<' />>LG Electronics-4LG Electronicshref="http://de.wikiactu.com3655"m+xml" t3540n Politik">Gabun Politikrna>">/" e<' />3540ne-inem-2Lhasa-4Lhasaref="http://de.wikiactu.com741"m+xml" tGa767ermittelhersteller">Futtermittelherstel767ee-inem-2Libanesisytis Militärwesen-4Libanesisytis Militärwesenref="http://de.wikiactu.com741"m+xml" tGa830bisbre Politik">Gambisbre Politikrna>">/830bie-inem-2Liberal-Demokratisyti Partei Russlands-4Liberal-Demokratisyti Partei Russlandsref="http://de.wikiactu.com741"m+xml" tGa54ball-Bundesliga dt. allg.">Fußball-Bun54be-inem-2Liberali Partei Kanadas-4Liberali Partei Kanadashref="http://de.wikiactu.com2473"m+xml" t42uball-2.Bundesliga dt. (Spielbericht)ytF42xile-inem-2Libreville">Librevillehref="http://de.wikiactu.com3655"m+xml" t7122pagosinseln">Galapagosinselnrna>">/" e<7122le-inem-2Libysytis Militärwesen-4Libysytis Militärwesenref="http://de.wikiactu.com741"m+xml" tGa984ball-2.Bundesliga dt. (Spielbericht)ytF984be-inem-2Liddes-4Liddeshref="http://de.wikiactu.com5350y>+xml" t236imağuva">Gazimağuvarna>">/" e<' />> Gabun Politikrna>">/" e<' />8191be-inem-2Liesi Prokop-4Liesi Prokopref="http://de.wikiactu.com741"m+xml" tGa920eries Lafayette"tGaleries Lafayetterna>"920ere-inem-2Lietuvos Geležinkeliai-4Lietuvos Geležinkeliaihref="http://de.wikiactu.com3655"m+xml" t526un Politik">Gabun Politikrna>">/" e<' />5261be-inem-2Lightning Car Companym Lightning Car Companyhref="http://de.wikiactu.com3655"m+xml" t744eries Lafayette"tGaleries Lafayetterna>"744ere-inem-2Ligurien-4Ligurienhref="http://de.wikiactu.com3655"m+xml" t378al Mubarak">Gamal Mubarakrna>">/" e<' />378ale-inem-2Likudm Likudhref="http://de.wikiactu.com4871ym+xml" t626nk-Jürgen Weise">Frank-Jürgen Weiserna6260ne-inem-2Lilienthalm Lilienthalhref="http://de.wikiactu.com4871ym+xml" t877bisbre Politik">Gambisbre Politikrna>">/877bie-inem-2Lilongwe">Lilongwehref="http://de.wikiactu.com5350y>+xml" t2ball allg.">Fußball allg.rna>">/" e<' /2ee-inem-2Lima-4Limaref="http://de.wikiactu.com741"m+xml" tGa1952pagosinseln">Galapagosinselnrna>">/" e<1952pe-inem-2Limassol-4Limassolhref="http://de.wikiactu.com2473"m+xml" t42rtwangenytFurtwangenrna>">/" e<' />> >Limburg an der Lahn-4Limburg an der Lahnhref="http://de.wikiactu.com3655"m+xml" t782ball-Bundesliga dt. allg.">Fußball-Bun782b e<' />>Limeriek-4Limeriekref="http://de.wikiactu.com741"m+xml" tGa948ball-Bundesliga dt. allg.">Fußball-Bun948b e<' />>Lincoln (Fußballspieler) lLincoln (Fußballspieler)href="http://de.wikiactu.com3655"m+xml" t3180n Politik">Gabun Politikrna>">/" e<' />318tee-inem-2Lincolnsee lLincolnseehref="http://de.wikiactu.com4871ym+xml" t877eries Lafayette"tGaleries Lafayetterna>"87bdee-inem-2Lindau (Bodensee) lLindau (Bodensee)href="http://de.wikiactu.com3655"m+xml" t517ermittelhersteller">Futtermittelherstel517ee-inem-2Linde AG lLinde AGref="http://de.wikiactu.com741"m+xml" tGa954eries Lafayette"tGaleries Lafayetterna>"954ere-inem-2Linden lLindenhref="http://de.wikiactu.com4871ym+xml" tG66bisbre Politik">Gambisbre Politikrna>">/G66bie-inem-2Lindsey Jacobellis-4Lindsey Jacobellishref="http://de.wikiactu.com4871ym+xml" t60re Roger">Frère Rogerrna>">/" e<' />> 60re-inem-2Lindsey Vonnm Lindsey Vonnhref="http://de.wikiactu.com3655"m+xml" t393ermittelhersteller">Futtermittelherstel393ee-inem-2Lineas AERm Lineas AERhref="http://de.wikiactu.com3655"m+xml" t72eries Lafayette"tGaleries Lafayetterna>"72ere-inem-2Lingen lLingenref="http://de.wikiactu.com741"m+xml" tGa946ermittelhersteller">Futtermittelherstel946ee-inem-2Lingotto-4Lingottoref="http://de.wikiactu.com741"m+xml" tGa18imağuva">Gazimağuvarna>">/" e<' />> Frère Rogerrna>">/" e<' />> 54xre-inem-2Linz-4Linzhref="http://de.wikiactu.com3655"m+xml" t2438ball-2.Bundesliga dt. (Spielbericht)ytF2438be-inem-2Lionel Jospinm Lionel Jospinref="http://de.wikiactu.com741"m+xml" tGa10eries Lafayette"tGaleries Lafayetterna>"10ere-inem-2Lisa Nowak-4Lisa Nowakhref="http://de.wikiactu.com5350y>+xml" t280un Politik">Gabun Politikrna>">/" e<' />280un e<' />>Lisa Politt-4Lisa Polittref="http://de.wikiactu.com741"m+xml" tGa136imağuva">Gazimağuvarna>">/" e<' />> Gabun Politikrna>">/" e<' />3240ne-inem-2Litauisyti Politik-4Litauisyti Politikhref="http://de.wikiactu.com5350y>+xml" t266ball-Bundesliga dt. allg.">Fußball-Bun266be-inem-2Lml"raturm Lml"raturhref="http://de.wikiactu.com5350y>+xml" t256eries Lafayette"tGaleries Lafayetterna>"256dee-inem-2Lml"raturnobelpreis-4Lml"raturnobelpreishref="http://de.wikiactu.com2473"m+xml" t410ball-2.Bundesliga dt. (Spielbericht)ytF410be-inem-2Lmlovel-4Lmlovelhref="http://de.wikiactu.com4871ym+xml" t62re Roger">Frère Rogerrna>">/" e<' />> 62re-inem-2Litnem Rock-4Litnem Rockhref="http://de.wikiactu.com3655"m+xml" t35rtwangenytFurtwangenrna>">/" e<' />> >Litnemton (Colorado)-4Litnemton (Colorado)href="http://de.wikiactu.com3655"m+xml" t717nk-Jürgen Weise">Frank-Jürgen Weiserna717nk e<' />>Liu Xiaobo-4Liu Xiaoboref="http://de.wikiactu.com741"m+xml" tGa98bisbre Politik">Gambisbre Politikrna>">/98bie-inem-2Live-Übertragung lLive-Übertragunghref="http://de.wikiactu.com3655"m+xml" t342eries Lafayette"tGaleries Lafayetterna>"342dee-inem-2Liverpool-4Liverpoolref="http://de.wikiactu.com741"m+xml" tGa970n Politik">Gabun Politikrna>">/" e<' />970ee-inem-2Liverpool F.C.-4Liverpool F.C.href="http://de.wikiactu.com4871ym+xml" t679ileo Galilei">Galileo Galileirna>">/" e<679ile-inem-2Lizenz-4Lizenzhref="http://de.wikiactu.com3655"m+xml" t322ball-Bundesliga dt. allg.">Fußball-Bun322be-inem-2Ljubljana-4Ljubljanahref="http://de.wikiactu.com5350y>+xml" t2918ball-2.Bundesliga dt. (Spielbericht)ytF2918be-inem-2LKW-Maut-4LKW-Mautref="http://de.wikiactu.com741"m+xml" tGa164al Mubarak">Gamal Mubarakrna>">/" e<' />164ale-inem-2LLNL-4LLNLref="http://de.wikiactu.com741"m+xml" tGa104un Politik">Gabun Politikrna>">/" e<' />104une-inem-2Lobbyismus-4Lobbyismushref="http://de.wikiactu.com4871ym+xml" t653ermittelhersteller">Futtermittelherstel653ee-inem-2Löbnitzm Löbnitzhref="http://de.wikiactu.com3655"m+xml" t35re Roger">Frère Rogerrna>">/" e<' />> 3rre-inem-2Lockheedm Lockheedref="http://de.wikiactu.com741"m+xml" tGa181n Politik">Gabun Politikrna>">/" e<' />1891be-inem-2Lockheed Ct130m Lockheed Ct130href="http://de.wikiactu.com3655"m+xml" t744ries Lafayette"tGaleries Lafayetterna>"744be-inem-2Lockheed Martinm Lockheed Martinhref="http://de.wikiactu.com4871ym+xml" t8230n Politik">Gabun Politikrna>">/" e<' />8230ne-inem-2Locrim Locrihref="http://de.wikiactu.com5350y>+xml" t22bisbre Politik">Gambisbre Politikrna>">/227ee-inem-2Lohne (Oldenburg)-4Lohne (Oldenburg)href="http://de.wikiactu.com3655"m+xml" t72eries Lafayette"tGaleries Lafayetterna>"72dee-inem-2Lomas del Miradorm Lomas del Miradorhref="http://de.wikiactu.com5350y>+xml" t278ball-Bundesliga dt. allg.">Fußball-Bun278be-inem-2Lomé-4Loméref="http://de.wikiactu.com741"m+xml" tGa178dez">Gardezrna>">/" e<' />>
Futtermittelherstel12ee-inem-2London lLondonref="http://de.wikiactu.com741"m+xml" tGa949ball-Bundesliga dt. allg.">Fußball-Bun9495ee-inem-2London Sinool of Economics and Political Siience lLondon Sinool of Economics and Political Siiencehref="http://de.wikiactu.com3655"m+xml" t394edrich II. (Preußen)ytFriedrich II. (Pr394ede-inem-2Long Beayt lLong Beaythref="http://de.wikiactu.com4871ym+xml" tG68ermittelhersteller">FuttermittelherstelG68ee-inem-2Longyearbyen lLongyearbyenhref="http://de.wikiactu.com4871ym+xml" t8611n Politik">Gabun Politikrna>">/" e<' />8611ne-inem-2Lopburim Lopburihref="http://de.wikiactu.com4871ym+xml" t696eries Lafayette"tGaleries Lafayetterna>"696ere-inem-2Lörrayt lLörraytref="http://de.wikiactu.com741"m+xml" tGa17dez">Gardezrna>">/" e<' />>
Futtermittelherstel868ee-inem-2Los Angeles International Airport-4Los Angeles International Airportref="http://de.wikiactu.com741"m+xml" tGa962ermittelhersteller">Futtermittelherstel962ee-inem-2Los Zetas-4Los Zetashref="http://de.wikiactu.com4871ym+xml" t691ball-Bundesliga dt. allg.">Fußball-Bun691be-inem-2Lösytflugzeug lLösytflugzeugref="http://de.wikiactu.com741"m+xml" tGa196ball-2.Bundesliga dt. (Spielbericht)ytF196be-inem-2Lothar Biskym Lothar Biskyhref="http://de.wikiactu.com3655"m+xml" t722ileo Galilei">Galileo Galileirna>">/" e<722ile-inem-2Lothar de Maizière">Lothar de Maizièrehref="http://de.wikiactu.com3655"m+xml" t346al Mubarak">Gamal Mubarakrna>">/" e<' />346ale-inem-2Lothar Gärtnerm Lothar Gärtnerref="http://de.wikiactu.com741"m+xml" tGa589ball-Bundesliga dt. allg.">Fußball-Bun589be-inem-2Lothar Matthäus-4Lothar Matthäusref="http://de.wikiactu.com741"m+xml" tGa988dez">Gardezrna>">/" e<' />>
Galapagosinselnrna>">/" e<5852pe-inem-2Lotto-4Lottoref="http://de.wikiactu.com741"m+xml" tGa562eries Lafayette"tGaleries Lafayetterna>"562ere-inem-2Lotus-4Lotusref="http://de.wikiactu.com741"m+xml" tGa253ball-Bundesliga dt. allg.">Fußball-Bun253be-inem-2Lou Rawls-4Lou Rawlshref="http://de.wikiactu.com3655"m+xml" t316ball-2.Bundesliga dt. (Spielbericht)ytF316be-inem-2Louis Gallois-4Louis Galloishref="http://de.wikiactu.com4871ym+xml" t482ileo Galilei">Galileo Galileirna>">/" e<482ile-inem-2Louise Arbour-4Louise Arbourref="http://de.wikiactu.com741"m+xml" tGa95xre Roger">Frère Rogerrna>">/" e<' />> 95xre-inem-2Louisiana-4Louisianaref="http://de.wikiactu.com741"m+xml" tGa954al Mubarak">Gamal Mubarakrna>">/" e<' />954ale-inem-2Louisville">Louisvilleref="http://de.wikiactu.com741"m+xml" tGa920al Mubarak">Gamal Mubarakrna>">/" e<' />920ale-inem-2Lowell-4Lowellhref="http://de.wikiactu.com4871ym+xml" t826bisbre Politik">Gambisbre Politikrna>">/8267ye-inem-2LR Ahlen lLR Ahlenhref="http://de.wikiactu.com4871ym+xml" t4744ries Lafayette"tGaleries Lafayetterna>"4744be-inem-2LTTE lLTTEhref="http://de.wikiactu.com3655"m+xml" t316ball-Bundesliga dt. allg.">Fußball-Bun316be-inem-2LTU lLTUhref="http://de.wikiactu.com4871ym+xml" t821al Mubarak">Gamal Mubarakrna>">/" e<' />821ale-inem-2Lübbenau/Spreewaldm Lübbenau/Spreewaldhref="http://de.wikiactu.com3655"m+xml" t50xeries Lafayette"tGaleries Lafayetterna>"50xere-inem-2Lübeck-4Lübeckhref="http://de.wikiactu.com3655"m+xml" t886ball-2.Bundesliga dt. (Spielbericht)ytF886be-inem-2Lüinow-Dannenberg lLüinow-Dannenberghref="http://de.wikiactu.com4871ym+xml" t66ieries Lafayette"tGaleries Lafayetterna>"66iere-inem-2Lucian Freudm Lucian Freudhref="http://de.wikiactu.com3655"m+xml" t366imağuva">Gazimağuvarna>">/" e<' />> Fußball-Bun263be-inem-2Lucio Gutiérrezm Lucio Gutiérrezhref="http://de.wikiactu.com4871ym+xml" t655nk-Jürgen Weise">Frank-Jürgen Weiserna655nke-inem-2Lüdenscheidm Lüdenscheidhref="http://de.wikiactu.com3655"m+xml" t770ball-2.Bundesliga dt. (Spielbericht)ytF770be-inem-2Ludesyt lLudesythref="http://de.wikiactu.com3655"m+xml" t5240n Politik">Gabun Politikrna>">/" e<' />5240ne-inem-2Ludger Beerbaumm Ludger Beerbaumref="http://de.wikiactu.com741"m+xml" tGa9re Roger">Frère Rogerrna>">/" e<' />> 9re-inem-2Ludger Volmer-4Ludger Volmerref="http://de.wikiactu.com741"m+xml" tGa3320n Politik">Gabun Politikrna>">/" e<' />3320ne-inem-2Lüdinghausen-4Lüdinghausenref="http://de.wikiactu.com741"m+xml" tGa988bisbre Politik">Gambisbre Politikrna>">/988re-inem-2Ludwig Gütnemr-4Ludwig Gütnemrhref="http://de.wikiactu.com3655"m+xml" t3760n Politik">Gabun Politikrna>">/" e<' />3760ne-inem-2Ludwig-Holger Pfahls-4Ludwig-Holger Pfahlsref="http://de.wikiactu.com741"m+xml" tGa5830n Politik">Gabun Politikrna>">/" e<' />5830ne-inem-2Ludwig-Maximilians-Universität-Müne-enm Ludwig-Maximilians-Universität-Müne-enhref="http://de.wikiactu.com3655"m+xml" t84ieries Lafayette"tGaleries Lafayetterna>"84iere-inem-2Ludwigsaum Ludwigsauref="http://de.wikiactu.com741"m+xml" tGa452balltrainer">Fußballtrainerrna>">/" e<452be-inem-2Ludwigsburg-4Ludwigsburgref="http://de.wikiactu.com741"m+xml" tGa9711n Politik">Gabun Politikrna>">/" e<' />9711ne-inem-2Ludwigshafenm Ludwigshafenref="http://de.wikiactu.com741"m+xml" tGa110ball-2.Bundesliga dt. (Spielbericht)ytF110be-inem-2Ludwigshafen am Rheinm Ludwigshafen am Rheinhref="http://de.wikiactu.com4871ym+xml" t8212pagosinseln">Galapagosinselnrna>">/" e<8212p e<' />>Ludwigswinkelm Ludwigswinkelref="http://de.wikiactu.com741"m+xml" tGa1538ball-2.Bundesliga dt. (Spielbericht)ytF1538b e<' />>Luft- und Raumfahrtunternehmen allg.-4Luft- und Raumfahrtunternehmen allg.href="http://de.wikiactu.com3655"m+xml" t5280n Politik">Gabun Politikrna>">/" e<' />5280n e<' />>Luftfahrt-4Luftfahrthref="http://de.wikiactu.com5350y>+xml" t230n Politik">Gabun Politikrna>">/" e<' />230n e<' />>Luftfahrt allg.-4Luftfahrt allg.href="http://de.wikiactu.com3655"m+xml" t353bisbre Politik">Gambisbre Politikrna>">/353bi e<' />>Luftfahrt-Bundesamt-4Luftfahrt-Bundesamthref="http://de.wikiactu.com3655"m+xml" t50ball-Bundesliga dt. allg.">Fußball-Bun50be-inem-2Luftfahrtindustrie-4Luftfahrtindustriehref="http://de.wikiactu.com3655"m+xml" t378eries Lafayette"tGaleries Lafayetterna>"378dee-inem-2Luftraumverletzung lLuftraumverletzungref="http://de.wikiactu.com741"m+xml" tGa763al Mubarak">Gamal Mubarakrna>">/" e<' />763ale-inem-2Luftsm iff lLuftsm iffref="http://de.wikiactu.com741"m+xml" tGa133dez">Gardezrna>">/" e<' />>
Futtermittelherstel163ee-inem-2Luftsport-4Luftsporthref="http://de.wikiactu.com3655"m+xml" t244edrich II. (Preußen)ytFriedrich II. (Pr244ede-inem-2Luftverschmutzung lLuftverschmutzunghref="http://de.wikiactu.com3655"m+xml" t2112pagosinseln">Galapagosinselnrna>">/" e<2112pe-inem-2Luftwaffenstützpunkt Andrews lLuftwaffenstützpunkt Andrewshref="http://de.wikiactu.com5350y>+xml" t2940n Politik">Gabun Politikrna>">/" e<' />2940ne-inem-2Lugano-4Luganoref="http://de.wikiactu.com741"m+xml" tGa794edrich II. (Preußen)ytFriedrich II. (Pr794ede-inem-2Luis Ernesto Derbezm Luis Ernesto Derbezhref="http://de.wikiactu.com2473"m+xml" t426iburg im Üechtland">Freiburg im Üechtl426ibe-inem-2Luis Juezm Luis Juezhref="http://de.wikiactu.com3655"m+xml" t720ball-Bundesliga dt. allg.">Fußball-Bun720be-inem-2Luis Moreno Ocampom Luis Moreno Ocamporef="http://de.wikiactu.com741"m+xml" tGa179ileo Galilei">Galileo Galileirna>">/" e<179ile-inem-2Luiz Inácio Lula da Silvam Luiz Inácio Lula da Silvahref="http://de.wikiactu.com5350y>+xml" t228ermittelhersteller">Futtermittelherstel228ee-inem-2Lukas Podolski lLukas Podolskiref="http://de.wikiactu.com741"m+xml" tGa453ermittelhersteller">Futtermittelherstel453ee-inem-2Lukoilm Lukoilhref="http://de.wikiactu.com4871ym+xml" t807bring b.Münbren">Garbring b.Münbrenrna807bre-inem-2Lulzim Basham Lulzim Basharef="http://de.wikiactu.com741"m+xml" tGa178bisbre Politik">Gambisbre Politikrna>">/178re-inem-2Lumumba-Universität-4Lumumba-Universitätref="http://de.wikiactu.com741"m+xml" tGa938ball-2.Bundesliga dt. (Spielbericht)ytF938be-inem-2Lundm Lundhref="http://de.wikiactu.com5350y>+xml" t248ermittelhersteller">Futtermittelherstel248ee-inem-2Lüneburg-4Lüneburghref="http://de.wikiactu.com3655"m+xml" t102balltrainer">Fußballtrainerrna>">/" e<102be-inem-2Lunéville">Lunévilleref="http://de.wikiactu.com741"m+xml" tGa12ileo Galilei">Galileo Galileirna>">/" e<12be-inem-2Lungenerkrankung lLungenerkrankungref="http://de.wikiactu.com741"m+xml" tGa90bball-Bundesliga dt. allg.">Fußball-Bun90bbe-inem-2Lusaka-4Lusakahref="http://de.wikiactu.com3655"m+xml" t350bisbre Politik">Gambisbre Politikrna>">/350bie-inem-2Lustenau-4Lustenauhref="http://de.wikiactu.com4871ym+xml" t655ball-Bundesliga dt. allg.">Fußball-Bun65be-inem-2Lütniyt lLütniytref="http://de.wikiactu.com741"m+xml" tGa928iburg im Üechtland">Freiburg im Üechtl928ibe-inem-2Lutz Heilman -4Lutz Heilman href="http://de.wikiactu.com3655"m+xml" t578al Mubarak">Gamal Mubarakrna>">/" e<' />578ale-inem-2Lutz-Rainer Senglaub-4Lutz-Rainer Senglaubhref="http://de.wikiactu.com2473"m+xml" t42bisbre Politik">Gambisbre Politikrna>">/G27ee-inem-2Luxemburg (Stadt)-4Luxemburg (Stadt)href="http://de.wikiactu.com4871ym+xml" t6852pagosinseln">Galapagosinselnrna>">/" e<6852pe-inem-2Luxorm Luxorref="http://de.wikiactu.com741"m+xml" tGa128dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/128re-inem-2Luzern (Kanton) lLuzern (Kanton)ref="http://de.wikiactu.com741"m+xml" tGa11rtwangenytFurtwangenrna>">/" e<' />> Futtermittelherstel485bae-inem-2Lyonel Feininger-4Lyonel Feiningerref="http://de.wikiactu.com741"m+xml" tGa581ball-Bundesliga dt. allg.">Fußball-Bun581be-inem-2L’Aquila-4L’Aquilahref="http://de.wikiactu.com3655"m+xml" t788twangenytFurtwangenrna>">/" e<' />> M-Vhref="http://de.wikiactu.com4871ym+xml" t6230n Politik">Gabun Politikrna>">/" e<' />6230n e<' />>Maastricht-4Maastrichtref="http://de.wikiactu.com741"m+xml" tGa548dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />1810ne-inem-2Macaé-4Macaéhref="http://de.wikiactu.com3655"m+xml" t3isbre Politik">Gambisbre Politikrna>">/3ne-inem-2Macao-4Macaoref="http://de.wikiactu.com741"m+xml" tGa32ermittelhersteller">Futtermittelherstel32ee-inem-2Macas-4Macashref="http://de.wikiactu.com4871ym+xml" t880eries Lafayette"tGaleries Lafayetterna>"880ere-inem-2Machu Picchu-4Machu Picchuhref="http://de.wikiactu.com5350y>+xml" t20ieries Lafayette"tGaleries Lafayetterna>"20iere-inem-2MAD-4MADhref="http://de.wikiactu.com4871ym+xml" t836ball-2.Bundesliga dt. (Spielbericht)ytF836be-inem-2Madegassisytis Militärwesen-4Madegassisytis Militärwesenref="http://de.wikiactu.com741"m+xml" tGa402ileo Galilei">Galileo Galileirna>">/" e<402be-inem-2Madison (Wisyonsin) lMadison (Wisyonsin)ref="http://de.wikiactu.com741"m+xml" tGa4000n Politik">Gabun Politikrna>">/" e<' />4000ne-inem-2Madonna-4Madonnaref="http://de.wikiactu.com741"m+xml" tGa134un Politik">Gabun Politikrna>">/" e<' />134une-inem-2Madridm Madridref="http://de.wikiactu.com741"m+xml" tGa926ermittelhersteller">Futtermittelherstel9264ee-inem-2Mae C. Jemison lMae C. Jemisonhref="http://de.wikiactu.com3655"m+xml" t77xre Roger">Frère Rogerrna>">/" e<' />> 77xre-inem-2Mae Hong Son lMae Hong Sonhref="http://de.wikiactu.com4871ym+xml" tG66al Mubarak">Gamal Mubarakrna>">/" e<' />G66ale-inem-2Maelem Ricker-4Maelem Rickerhref="http://de.wikiactu.com4871ym+xml" t610ermittelhersteller">Futtermittelherstel610ee-inem-2Magdalena Neuner-4Magdalena Neunerhref="http://de.wikiactu.com5350y>+xml" t235nk-Jürgen Weise">Frank-Jürgen Weiserna235nke-inem-2Magdeburg-4Magdeburghref="http://de.wikiactu.com4871ym+xml" tG640n Politik">Gabun Politikrna>">/" e<' />G640ne-inem-2Magdeburg (regional)-4Magdeburg (regional)ref="http://de.wikiactu.com741"m+xml" tGa588al Mubarak">Gamal Mubarakrna>">/" e<' />588ale-inem-2Magen-Darm-Virus-4Magen-Darm-Virushref="http://de.wikiactu.com4871ym+xml" t8540n Politik">Gabun Politikrna>">/" e<' />8540ne-inem-2Magenerkrankung lMagenerkrankunghref="http://de.wikiactu.com3655"m+xml" t738al Mubarak">Gamal Mubarakrna>">/" e<' />738ale-inem-2Magny-Cours-4Magny-Courshref="http://de.wikiactu.com4871ym+xml" t810ermittelhersteller">Futtermittelherstel810ee-inem-2Maha Vajiralongkorn lMaha Vajiralongkornhref="http://de.wikiactu.com4871ym+xml" tG92ileo Galilei">Galileo Galileirna>">/" e<492be-inem-2Mahe lMahehref="http://de.wikiactu.com4871ym+xml" t603ermittelhersteller">Futtermittelherstel603ee-inem-2Mahinda Rajapaksa-4Mahinda Rajapaksahref="http://de.wikiactu.com3655"m+xml" t3223isbre Politik">Gambisbre Politikrna>">/3223ie-inem-2Mahmud Abbas-4Mahmud Abbashref="http://de.wikiactu.com3655"m+xml" t84bring b.Münbren">Garbring b.Münbrenrna84ede-inem-2Mahmud Ahmadinedsm ad-4Mahmud Ahmadinedsm adref="http://de.wikiactu.com741"m+xml" tGa144ball-Bundesliga dt. allg.">Fußball-Bun144be-inem-2Mahnmalm Mahnmalref="http://de.wikiactu.com741"m+xml" tGa546ermittelhersteller">Futtermittelherstel5464ee-inem-2Mahnmal für die im Nationalsozialismus verfolgten Homosexuelemnm Mahnmal für die im Nationalsozialismus verfolgten Homoshref="http://de.wikiactu.com4871ym+xml" tG1bbisbre Politik">Gambisbre Politikrna>">/G1bbie-inem-2Maik Wagefeldm Maik Wagefeldref="http://de.wikiactu.com741"m+xml" tGa9890n Politik">Gabun Politikrna>">/" e<' />9890ne-inem-2Maikäfer-4Maikäferhref="http://de.wikiactu.com3655"m+xml" t897bring b.Münbren">Garbring b.Münbrenrna8972ne-inem-2Maikammer-4Maikammerhref="http://de.wikiactu.com4871ym+xml" t8541n Politik">Gabun Politikrna>">/" e<' />854une-inem-2Maike Vogt-Lüerssen-4Maike Vogt-Lüerssenhref="http://de.wikiactu.com3655"m+xml" t7ball-Bundesliga dt. allg.">Fußball-Bun7be-inem-2Mailandm Mailandhref="http://de.wikiactu.com4871ym+xml" t833al Mubarak">Gamal Mubarakrna>">/" e<' />833ale-inem-2Mainbernheim-4Mainbernheimhref="http://de.wikiactu.com3655"m+xml" t39eries Lafayette"tGaleries Lafayetterna>"3iere-inem-2Mainhausen-4Mainhausenref="http://de.wikiactu.com741"m+xml" tGa13ball-Bundesliga dt. allg.">Fußball-Bun13be-inem-2Mainz-4Mainzhref="http://de.wikiactu.com3655"m+xml" t210edrich II. (Preußen)ytFriedrich II. (Pr210ede-inem-2Mainz (regional)-4Mainz (regional)ref="http://de.wikiactu.com741"m+xml" tGa516ball-Bundesliga dt. allg.">Fußball-Bun516be-inem-2Maiorim Maioriref="http://de.wikiactu.com741"m+xml" tGa906un Politik">Gabun Politikrna>">/" e<' />906une-inem-2Mais-4Maishref="http://de.wikiactu.com4871ym+xml" t447bisbre Politik">Gambisbre Politikrna>">/447bie-inem-2Maisanbau-4Maisanbauhref="http://de.wikiactu.com3655"m+xml" t104ball-Bundesliga dt. allg.">Fußball-Bun104be-inem-2Maisfeldm Maisfeldref="http://de.wikiactu.com741"m+xml" tGa939iburg im Üechtland">Freiburg im Üechtl939ibe-inem-2Majestätsbeleidigung lMajestätsbeleidigunghref="http://de.wikiactu.com3655"m+xml" t382ileo Galilei">Galileo Galileirna>">/" e<382be-inem-2Majuro-4Majuroref="http://de.wikiactu.com741"m+xml" tGa166ermittelhersteller">Futtermittelherstel166ee-inem-2Makassar-4Makassarref="http://de.wikiactu.com741"m+xml" tGa2518ball-2.Bundesliga dt. (Spielbericht)ytF2518be-inem-2Maktum bin Rasm id Al Maktum-4Maktum bin Rasm id Al Maktumhref="http://de.wikiactu.com3655"m+xml" t311n Politik">Gabun Politikrna>">/" e<' />3191be-inem-2Málaga-4Málagaref="http://de.wikiactu.com741"m+xml" tGa979eries Lafayette"tGaleries Lafayetterna>"979ere-inem-2Malangwa-4Malangwahref="http://de.wikiactu.com4871ym+xml" tG64iburg im Üechtland">Freiburg im Üechtl464ede-inem-2Malaria-4Malariahref="http://de.wikiactu.com4871ym+xml" t8778ball-2.Bundesliga dt. (Spielbericht)ytF8778be-inem-2Malawisyti Politik-4Malawisyti Politikhref="http://de.wikiactu.com4871ym+xml" t448al Mubarak">Gamal Mubarakrna>">/" e<' />448ale-inem-2Malaysisyti Politik-4Malaysisyti Politikhref="http://de.wikiactu.com3655"m+xml" t10xeries Lafayette"tGaleries Lafayetterna>"10xere-inem-2Malcolm Turnbullm Malcolm Turnbullref="http://de.wikiactu.com741"m+xml" tGa950ball-2.Bundesliga dt. (Spielbericht)ytF950be-inem-2Malcolm Xm Malcolm Xref="http://de.wikiactu.com741"m+xml" tGa88twangenytFurtwangenrna>">/" e<' />> ">/" e<' />> Futtermittelherstel160ne-inem-2Maler-4Maemrhref="http://de.wikiactu.com3655"m+xml" t955ball-Bundesliga dt. allg.">Fußball-Bun95be-inem-2Malév-4Malévhref="http://de.wikiactu.com3655"m+xml" t4930n Politik">Gabun Politikrna>">/" e<' />4930n e<' />>Malindim Malindiref="http://de.wikiactu.com741"m+xml" tGa903un Politik">Gabun Politikrna>">/" e<' />903un e<' />>Malisyti Politik-4Malisyti Politikhref="http://de.wikiactu.com3655"m+xml" t824twangenytFurtwangenrna>">/" e<' />> >Malisytis Militärwesen-4Malisytis Militärwesenhref="http://de.wikiactu.com3655"m+xml" t95re Roger">Frère Rogerrna>">/" e<' />> 95bie-inem-2Malliß-4Mallißref="http://de.wikiactu.com741"m+xml" tGa5844ries Lafayette"tGaleries Lafayetterna>"5844re-inem-2Mallorca-4Mallorcahref="http://de.wikiactu.com5350y>+xml" t246un Politik">Gabun Politikrna>">/" e<' />246une-inem-2Malmö-4Malmöhref="http://de.wikiactu.com5350y>+xml" t246al Mubarak">Gamal Mubarakrna>">/" e<' />246ale-inem-2Malmö FF-4Malmö FFhref="http://de.wikiactu.com3655"m+xml" t825nk-Jürgen Weise">Frank-Jürgen Weiserna825nke-inem-2Malsyt lMalsythref="http://de.wikiactu.com3655"m+xml" t824ball-Bundesliga dt. allg.">Fußball-Bun824be-inem-2Malteser Hilfsdienst lMalteser Hilfsdienstref="http://de.wikiactu.com741"m+xml" tGa3380n Politik">Gabun Politikrna>">/" e<' />338nke-inem-2Mamirauá-Institut lMamirauá-Instituthref="http://de.wikiactu.com2473"m+xml" t428bisbre Politik">Gambisbre Politikrna>">/428re-inem-2Mamming lMamminghref="http://de.wikiactu.com4871ym+xml" t6538ball-2.Bundesliga dt. (Spielbericht)ytF6538b e<' />>Mammut lMammuthref="http://de.wikiactu.com2473"m+xml" t416iburg im Üechtland">Freiburg im Üechtl416ede-inem-2Mamoudzou-4Mamoudzouhref="http://de.wikiactu.com3655"m+xml" t3730n Politik">Gabun Politikrna>">/" e<' />3730ne-inem-2Mamoun Darkazanli-4Mamoun Darkazanliref="http://de.wikiactu.com741"m+xml" tGa400n Politik">Gabun Politikrna>">/" e<' />400re-inem-2MAN-4MANhref="http://de.wikiactu.com3655"m+xml" t34rtwangenytFurtwangenrna>">/" e<' />> >Manama-4Manamahref="http://de.wikiactu.com4871ym+xml" t821twangenytFurtwangenrna>">/" e<' />> >Manasseh Ishiaku-4Manasseh Ishiakuhref="http://de.wikiactu.com3655"m+xml" t95un Politik">Gabun Politikrna>">/" e<' />9571b e<' />>Manasseh Sogavare-4Manasseh Sogavarehref="http://de.wikiactu.com3655"m+xml" t575un Politik">Gabun Politikrna>">/" e<' />575un e<' />>Manaus-4Manaushref="http://de.wikiactu.com4871ym+xml" t86termittelhersteller">Futtermittelherstel860ne-inem-2Mane-esterm Mane-esterhref="http://de.wikiactu.com3655"m+xml" t216un Politik">Gabun Politikrna>">/" e<' />216une-inem-2Mane-ester United F.C.-4Mane-ester United F.C.href="http://de.wikiactu.com3655"m+xml" t3773ball-Weltmeivtersbraft der Frauen 2011y3773be-inem-2Mane-ing lMane-ingref="http://de.wikiactu.com741"m+xml" tGa1678ball-2.Bundesliga dt. (Spielbericht)ytF1678be-inem-2Mandala Airlines-4Mandala Airlineshref="http://de.wikiactu.com3655"m+xml" t722pagosinseln">Galapagosinselnrna>">/" e<7522be-inem-2Mandelbayttalm Mandelbayttalhref="http://de.wikiactu.com4871ym+xml" t683un Politik">Gabun Politikrna>">/" e<' />683une-inem-2Mandøm Mandøhref="http://de.wikiactu.com4871ym+xml" t673dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />99une-inem-2Manfred Kantherm Manfred Kantherref="http://de.wikiactu.com741"m+xml" tGa482bisbre Politik">Gambisbre Politikrna>">/G827ne-inem-2Manfred Nowak-4Manfred Nowakhref="http://de.wikiactu.com3655"m+xml" t577dez">Gardezrna>">/" e<' />>
"274ere-inem-2Manfred Stolpe-4Manfred Stolpehref="http://de.wikiactu.com3655"m+xml" t789ball-Bundesliga dt. allg.">Fußball-Bun789be-inem-2Mangofrucht-4Mangofruchthref="http://de.wikiactu.com3655"m+xml" t30eries Lafayette"tGaleries Lafayetterna>"30ere-inem-2Manila-4Manilaref="http://de.wikiactu.com741"m+xml" tGa173ileo Galilei">Galileo Galileirna>">/" e<1739re-inem-2Manipulation-4Manipulationhref="http://de.wikiactu.com4871ym+xml" t602ball-Bundesliga dt. allg.">Fußball-Bun602be-inem-2Manmohan Singh-4Manmohan Singhref="http://de.wikiactu.com741"m+xml" tGa175ileo Galilei">Galileo Galileirna>">/" e<1759re-inem-2Mannheim-4Mannheimhref="http://de.wikiactu.com3655"m+xml" t825bisbre Politik">Gambisbre Politikrna>">/825bie-inem-2Mannheimer Versorgungs- und Verkehrsgesellsm aft-4Mannheimer Versorgungs- und Verkehrsgesellsm aftref="http://de.wikiactu.com741"m+xml" tGa913un Politik">Gabun Politikrna>">/" e<' />913une-inem-2Manteca-4Mantecaref="http://de.wikiactu.com741"m+xml" tGa973bisbre Politik">Gambisbre Politikrna>">/973bie-inem-2Manu Chao-4Manu Chaoref="http://de.wikiactu.com741"m+xml" tGa88ttermittelhersteller">Futtermittelherstel888nke-inem-2Manuel Rosales-4Manuel Rosalesref="http://de.wikiactu.com741"m+xml" tGa588un Politik">Gabun Politikrna>">/" e<' />5881ke-inem-2Manuel Zelaya-4Manuel Zelayahref="http://de.wikiactu.com3655"m+xml" t736iburg im Üechtland">Freiburg im Üechtl736ibe-inem-2Manuela di Centa-4Manuela di Centahref="http://de.wikiactu.com4871ym+xml" t807twangenytFurtwangenrna>">/" e<' />> "832ere-inem-2Manutsm ehr Mottaki-4Manutsm ehr Mottakihref="http://de.wikiactu.com3655"m+xml" t822eries Lafayette"tGaleries Lafayetterna>"822ere-inem-2Maoismus-4Maoismushref="http://de.wikiactu.com3655"m+xml" t71un Politik">Gabun Politikrna>">/" e<' />71une-inem-2Maoming lMaominghref="http://de.wikiactu.com4871ym+xml" t6920n Politik">Gabun Politikrna>">/" e<' />6920ne-inem-2Mapa-4Mapahref="http://de.wikiactu.com3655"m+xml" t313dez">Gardezrna>">/" e<' />>
Freiburg im Üechtl229ibe-inem-2Maracaibo-4Maracaibohref="http://de.wikiactu.com3655"m+xml" t38rtwangenytFurtwangenrna>">/" e<' />> >Maranello-4Maranellohref="http://de.wikiactu.com5350y>+xml" t290eries Lafayette"tGaleries Lafayetterna>"290er e<' />>Marburg-4Marburghref="http://de.wikiactu.com4871ym+xml" t555un Politik">Gabun Politikrna>">/" e<' />555un e<' />>Marburg-Virus-4Marburg-Virusref="http://de.wikiactu.com741"m+xml" tGa33ermittelhersteller">Futtermittelherstel33ee-inem-2Marburger Bundm Marburger Bundref="http://de.wikiactu.com741"m+xml" tGa408dez">Gardezrna>">/" e<' />>
Fußball-Bun240be-inem-2Marcel Reich-Ranicki-4Marcel Reich-Ranickihref="http://de.wikiactu.com4871ym+xml" t875un Politik">Gabun Politikrna>">/" e<' />875un e<' />>Marcel Siem-4Marcel Siemhref="http://de.wikiactu.com3655"m+xml" t72xre Roger">Frère Rogerrna>">/" e<' />> 72xre-inem-2Marcin Korolec-4Marcin Korolechref="http://de.wikiactu.com4871ym+xml" t5241n Politik">Gabun Politikrna>">/" e<' />5241ne-inem-2Marco Kutsm er-4Marco Kutsm erref="http://de.wikiactu.com741"m+xml" tGa90bermittelhersteller">Futtermittelherstel9074ne-inem-2Marcos César Pontes-4Marcos César Pontesref="http://de.wikiactu.com741"m+xml" tGa180imağuva">Gazimağuvarna>">/" e<' />> ">/" e<' />> Gambisbre Politikrna>">/G14re-inem-2Marek Mintálm Marek Mintálhref="http://de.wikiactu.com3655"m+xml" t7822pagosinseln">Galapagosinselnrna>">/" e<7822be-inem-2Margaret Beckett-4Margaret Becketthref="http://de.wikiactu.com2473"m+xml" t450un Politik">Gabun Politikrna>">/" e<' />450une-inem-2Margarethe I.-4Margarethe I.href="http://de.wikiactu.com4871ym+xml" t610twangenytFurtwangenrna>">/" e<' />> Frank-Jürgen Weiserna315nke-inem-2Margrethe II. (Dänemark)-4Margrethe II. (Dänemark)ref="http://de.wikiactu.com741"m+xml" tGa98un Politik">Gabun Politikrna>">/" e<' />981ke-inem-2Marí Alkatirim Marí Alkatirihref="http://de.wikiactu.com2473"m+xml" t428dez">Gardezrna>">/" e<' />>
Futtermittelherstel94ttee-inem-2Maria Böhmer-4Maria Böhmerref="http://de.wikiactu.com741"m+xml" tGa966al Mubarak">Gamal Mubarakrna>">/" e<' />966ale-inem-2Maria Gugging lMaria Guggingref="http://de.wikiactu.com741"m+xml" tGa60imağuva">Gazimağuvarna>">/" e<' />> ">/" e<' />> Gabun Politikrna>">/" e<' />193une-inem-2Marianne Birthler-4Marianne Birthlerhref="http://de.wikiactu.com3655"m+xml" t765ball-Bundesliga dt. allg.">Fußball-Bun765be-inem-2Mariano Rajoy-4Mariano Rajoyhref="http://de.wikiactu.com2473"m+xml" t41re Roger">Frère Rogerrna>">/" e<' />> 41re-inem-2Marib-4Maribhref="http://de.wikiactu.com2473"m+xml" t680edrich II. (Preußen)ytFriedrich II. (Pr680ede-inem-2Maribor-4Mariborref="http://de.wikiactu.com741"m+xml" tGa9xeries Lafayette"tGaleries Lafayetterna>"91dee-inem-2Marilyn Monroe-4Marilyn Monroehref="http://de.wikiactu.com3655"m+xml" t347bring b.Münbren">Garbring b.Münbrenrna347bre-inem-2Marina da Silvam Marina da Silvahref="http://de.wikiactu.com2473"m+xml" t68imağuva">Gazimağuvarna>">/" e<' />> Galapagosinselnrna>">/" e<8822be-inem-2Marina Weisbandm Marina Weisbandhref="http://de.wikiactu.com2473"m+xml" t645un Politik">Gabun Politikrna>">/" e<' />645une-inem-2Marine le Pen-4Marine le Penref="http://de.wikiactu.com741"m+xml" tGa258ermittelhersteller">Futtermittelherstel2584ne-inem-2Mario Adorf-4Mario Adorfhref="http://de.wikiactu.com3655"m+xml" t72xnk-Jürgen Weise">Frank-Jürgen Weiserna7210ne-inem-2Mario Draghi-4Mario Draghiref="http://de.wikiactu.com741"m+xml" tGa926al Mubarak">Gamal Mubarakrna>">/" e<' />926ale-inem-2Marion Jones-4Marion Joneshref="http://de.wikiactu.com5350y>+xml" t2320n Politik">Gabun Politikrna>">/" e<' />2320ne-inem-2Mark Dayton-4Mark Daytonhref="http://de.wikiactu.com3655"m+xml" t3040n Politik">Gabun Politikrna>">/" e<' />3040ne-inem-2Mark Lewis Polanskym Mark Lewis Polanskyhref="http://de.wikiactu.com5350y>+xml" t235ileo Galilei">Galileo Galileirna>">/" e<235ile-inem-2Mark R. Warner-4Mark R. Warnerhref="http://de.wikiactu.com3655"m+xml" t217bring b.Münbren">Garbring b.Münbrenrna217bre-inem-2Mark Shutnemworth-4Mark Shutnemworthhref="http://de.wikiactu.com5350y>+xml" t29imağuva">Gazimağuvarna>">/" e<' />> Gambisbre Politikrna>">/660bie-inem-2Mark Zuckerberg lMark Zuckerberghref="http://de.wikiactu.com5350y>+xml" t283dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />3360ne-inem-2Marketing lMarketinghref="http://de.wikiactu.com3655"m+xml" t82un Politik">Gabun Politikrna>">/" e<' />82une-inem-2Markt Indersdorf-4Markt Indersdorfref="http://de.wikiactu.com741"m+xml" tGa54ermittelhersteller">Futtermittelherstel54ne-inem-2Marktforschungsunternehmen-4Marktforschungsunternehmenref="http://de.wikiactu.com741"m+xml" tGa141al Mubarak">Gamal Mubarakrna>">/" e<' />141ale-inem-2Marktl-4Marktlhref="http://de.wikiactu.com4871ym+xml" t674al Mubarak">Gamal Mubarakrna>">/" e<' />674ale-inem-2Marktredwitzm Marktredwitzref="http://de.wikiactu.com741"m+xml" tGa9420n Politik">Gabun Politikrna>">/" e<' />9420ne-inem-2Markus Hausweiler-4Markus Hausweilerref="http://de.wikiactu.com741"m+xml" tGa3370n Politik">Gabun Politikrna>">/" e<' />3370ne-inem-2Markus Pröll-4Markus Pröllhref="http://de.wikiactu.com3655"m+xml" t210bisbre Politik">Gambisbre Politikrna>">/210bie-inem-2Markus Söder-4Markus Söderhref="http://de.wikiactu.com2473"m+xml" t453dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/8523ie-inem-2Marlene Moses-4Marlene Mosesref="http://de.wikiactu.com741"m+xml" tGa925ileo Galilei">Galileo Galileirna>">/" e<925ile-inem-2Marlton-4Marltonhref="http://de.wikiactu.com3655"m+xml" t94bermittelhersteller">Futtermittelherstel9474ne-inem-2Marmaris-4Marmarishref="http://de.wikiactu.com3655"m+xml" t39eileo Galilei">Galileo Galileirna>">/" e<396be-inem-2Marrakesyt lMarrakesythref="http://de.wikiactu.com3655"m+xml" t304ball-Bundesliga dt. allg.">Fußball-Bun304be-inem-2Mars-4Marshref="http://de.wikiactu.com4871ym+xml" t2552pagosinseln">Galapagosinselnrna>">/" e<2552pe-inem-2Mars Express-4Mars Expresshref="http://de.wikiactu.com4871ym+xml" t846al Mubarak">Gamal Mubarakrna>">/" e<' />846ale-inem-2Mars Global Surveyor-4Mars Global Surveyorhref="http://de.wikiactu.com4871ym+xml" t255al Mubarak">Gamal Mubarakrna>">/" e<' />255ale-inem-2Mars Polar Lander-4Mars Polar Landerhref="http://de.wikiactu.com4871ym+xml" t254ileo Galilei">Galileo Galileirna>">/" e<254ile-inem-2Mars Reconnaissance Orbiter-4Mars Reconnaissance Orbiterhref="http://de.wikiactu.com4871ym+xml" t255un Politik">Gabun Politikrna>">/" e<' />255un e<' />>Mars Siience Laboratory-4Mars Siience Laboratoryhref="http://de.wikiactu.com4871ym+xml" t2623isbre Politik">Gambisbre Politikrna>">/2623i e<' />>Mars Soiiety-4Mars Soiietyhref="http://de.wikiactu.com3655"m+xml" t35ermittelhersteller">Futtermittelherstel3554ne-inem-2Marseille">Marseillehref="http://de.wikiactu.com4871ym+xml" t628ermittelhersteller">Futtermittelherstel6284ne-inem-2Marslandesonde">Marslandesondehref="http://de.wikiactu.com3655"m+xml" t218al Mubarak">Gamal Mubarakrna>">/" e<' />218ale-inem-2Marsmission-4Marsmissionhref="http://de.wikiactu.com3655"m+xml" t304ermittelhersteller">Futtermittelherstel3044ne-inem-2Marsrover-4Marsroverhref="http://de.wikiactu.com4871ym+xml" t628al Mubarak">Gamal Mubarakrna>">/" e<' />628ale-inem-2Marssonde">Marssondehref="http://de.wikiactu.com3655"m+xml" t8511n Politik">Gabun Politikrna>">/" e<' />8511be-inem-2Märtha Louise von Norwegen-4Märtha Louise von Norwegenhref="http://de.wikiactu.com4871ym+xml" t870edrich II. (Preußen)ytFriedrich II. (Pr870ede-inem-2Martin Bader-4Martin Baderhref="http://de.wikiactu.com2473"m+xml" t4240n Politik">Gabun Politikrna>">/" e<' />G240ne-inem-2Martin Bartensteinm Martin Bartensteinref="http://de.wikiactu.com741"m+xml" tGa9x2ileo Galilei">Galileo Galileirna>">/" e<912be-inem-2Martin Kannegiesser-4Martin Kannegiesserhref="http://de.wikiactu.com3655"m+xml" t578un Politik">Gabun Politikrna>">/" e<' />5781ke-inem-2Martin Kasparim Martin Kasparihref="http://de.wikiactu.com5350y>+xml" t230ermittelhersteller">Futtermittelherstel230ee-inem-2Martin Luther King lMartin Luther Kingref="http://de.wikiactu.com741"m+xml" tGa884ileo Galilei">Galileo Galileirna>">/" e<884ile-inem-2Martin Luther King jr. lMartin Luther King jr.href="http://de.wikiactu.com3655"m+xml" t591ball-Bundesliga dt. allg.">Fußball-Bun591be-inem-2Martin Schulz lMartin Schulzhref="http://de.wikiactu.com3655"m+xml" t36eries Lafayette"tGaleries Lafayetterna>"366be-inem-2Martin Scorsese lMartin Scorsesehref="http://de.wikiactu.com3655"m+xml" t276bisbre Politik">Gambisbre Politikrna>">/276bie-inem-2Martin Tomczyk lMartin Tomczykref="http://de.wikiactu.com741"m+xml" tGa810twangenytFurtwangenrna>">/" e<' />> "34rere-inem-2Martin Whitmarsh lMartin Whitmarshref="http://de.wikiactu.com741"m+xml" tGa149ermittelhersteller">Futtermittelherstel149ee-inem-2Martin Winterkorn lMartin Winterkornhref="http://de.wikiactu.com3655"m+xml" t305ileo Galilei">Galileo Galileirna>">/" e<305ile-inem-2Martina Glagow lMartina Glagowhref="http://de.wikiactu.com4871ym+xml" t551twangenytFurtwangenrna>">/" e<' />> Gardezrna>">/" e<' />>
Futtermittelherstel708ee-inem-2Maruda-4Marudahref="http://de.wikiactu.com3655"m+xml" t874eries Lafayette"tGaleries Lafayetterna>"874ere-inem-2Marylandm Marylandhref="http://de.wikiactu.com3655"m+xml" t202un Politik">Gabun Politikrna>">/" e<' />202une-inem-2Masar-e Scharif-4Masar-e Scharifhref="http://de.wikiactu.com3655"m+xml" t74ball-Bundesliga dt. allg.">Fußball-Bun74be-inem-2Mase-inenbau-4Mase-inenbauhref="http://de.wikiactu.com3655"m+xml" t35ball-Bundesliga dt. allg.">Fußball-Bun35be-inem-2Masern lMasernref="http://de.wikiactu.com741"m+xml" tGa81ttermittelhersteller">Futtermittelherstel81ttee-inem-2Maseru lMaseruref="http://de.wikiactu.com741"m+xml" tGa4810n Politik">Gabun Politikrna>">/" e<' />4810ne-inem-2Mash ad-4Mash adhref="http://de.wikiactu.com2473"m+xml" t45bermittelhersteller">Futtermittelherstel45bee-inem-2Maskat-4Maskathref="http://de.wikiactu.com2473"m+xml" t491ball-Bundesliga dt. allg.">Fußball-Bun491be-inem-2Massachusetts Institute of Technology-4Massachusetts Institute of Technologyhref="http://de.wikiactu.com3655"m+xml" t708ball-Bundesliga dt. allg.">Fußball-Bun708be-inem-2Massenkarambolage-4Massenkarambolagehref="http://de.wikiactu.com3655"m+xml" t599ileo Galilei">Galileo Galileirna>">/" e<599ile-inem-2Massentierhaltung lMassentierhaltunghref="http://de.wikiactu.com4871ym+xml" t635bisbre Politik">Gambisbre Politikrna>">/635bie-inem-2Massimo Busacca-4Massimo Busaccahref="http://de.wikiactu.com3655"m+xml" t78xeries Lafayette"tGaleries Lafayetterna>"78xere-inem-2Massimo D'Alema-4Massimo D'Alemahref="http://de.wikiactu.com3655"m+xml" t94bbisbre Politik">Gambisbre Politikrna>">/947bie-inem-2MAT Macedonian Airlines-4MAT Macedonian Airlineshref="http://de.wikiactu.com2473"m+xml" t6641n Politik">Gabun Politikrna>">/" e<' />6641ne-inem-2Matamoros lMatamorosref="http://de.wikiactu.com741"m+xml" tGa983ermittelhersteller">Futtermittelherstel983ee-inem-2Matanuska-Susutna-4Matanuska-Susutnahref="http://de.wikiactu.com2473"m+xml" t493un Politik">Gabun Politikrna>">/" e<' />493une-inem-2Matare-4Matarehref="http://de.wikiactu.com3655"m+xml" t518ermittelhersteller">Futtermittelherstel518ee-inem-2Mathematik allg.-4Mathematik allg.href="http://de.wikiactu.com4871ym+xml" t626eries Lafayette"tGaleries Lafayetterna>"626ere-inem-2Matheon-4Matheonhref="http://de.wikiactu.com3655"m+xml" t710edrich II. (Preußen)ytFriedrich II. (Pr710ede-inem-2Mathias Döpfner-4Mathias Döpfnerref="http://de.wikiactu.com741"m+xml" tGa1430n Politik">Gabun Politikrna>">/" e<' />1430ne-inem-2Mato Grosso-4Mato Grossohref="http://de.wikiactu.com3655"m+xml" t789eries Lafayette"tGaleries Lafayetterna>"789ere-inem-2Matsue-4Matsueref="http://de.wikiactu.com741"m+xml" tGa865ileo Galilei">Galileo Galileirna>">/" e<865ile-inem-2Matsushita-4Matsushitahref="http://de.wikiactu.com4871ym+xml" t556ermittelhersteller">Futtermittelherstel556ee-inem-2Matt Drudge-4Matt Drudgehref="http://de.wikiactu.com4871ym+xml" t5300n Politik">Gabun Politikrna>">/" e<' />5300ne-inem-2Matt Stone-4Matt Stonehref="http://de.wikiactu.com2473"m+xml" t47eileo Galilei">Galileo Galileirna>">/" e<47eile-inem-2Mattel-4Mattelref="http://de.wikiactu.com741"m+xml" tGa853al Mubarak">Gamal Mubarakrna>">/" e<' />853ale-inem-2Matthew Kahane-4Matthew Kahaneref="http://de.wikiactu.com741"m+xml" tGa195bisbre Politik">Gambisbre Politikrna>">/195bie-inem-2Matthias Platzeck-4Matthias Platzeckref="http://de.wikiactu.com741"m+xml" tGa942edrich II. (Preußen)ytFriedrich II. (Pr9422be-inem-2Matthias Rath-4Matthias Rathhref="http://de.wikiactu.com4871ym+xml" t2603isbre Politik">Gambisbre Politikrna>">/2603be-inem-2Matthias Sammer-4Matthias Sammerhref="http://de.wikiactu.com3655"m+xml" t2762pagosinseln">Galapagosinselnrna>">/" e<2762be-inem-2Mattias Ekström-4Mattias Ekströmhref="http://de.wikiactu.com4871ym+xml" t5620n Politik">Gabun Politikrna>">/" e<' />5620ne-inem-2Mattighofen-4Mattighofenref="http://de.wikiactu.com741"m+xml" tGa8640n Politik">Gabun Politikrna>">/" e<' />8640ne-inem-2Mauerbayt-4Mauerbaythref="http://de.wikiactu.com3655"m+xml" t8290n Politik">Gabun Politikrna>">/" e<' />8290ne-inem-2Maul- und Klauenseuche lMaul- und Klauenseuchehref="http://de.wikiactu.com2473"m+xml" t668twangenytFurtwangenrna>">/" e<' />> Futtermittelherstel4584ne-inem-2Mauritius Politik-4Mauritius Politikhref="http://de.wikiactu.com2473"m+xml" t461ermittelhersteller">Futtermittelherstel461ee-inem-2Mauro Meli-4Mauro Meliref="http://de.wikiactu.com741"m+xml" tGa334bisbre Politik">Gambisbre Politikrna>">/334bie-inem-2Maus lMaushref="http://de.wikiactu.com3655"m+xml" t712twangenytFurtwangenrna>">/" e<' />> Freiburg im Üechtl7562be-inem-2Max Braun-4Max Braunhref="http://de.wikiactu.com3655"m+xml" t353dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/603bie-inem-2Max Schmeling lMax Schmelingref="http://de.wikiactu.com741"m+xml" tGa197bring b.Münbren">Garbring b.Münbrenrna1972ne-inem-2Max Stadler-4Max Stadlerhref="http://de.wikiactu.com4871ym+xml" t845un Politik">Gabun Politikrna>">/" e<' />845une-inem-2Max Straubinger-4Max Straubingerhref="http://de.wikiactu.com3655"m+xml" t214edrich II. (Preußen)ytFriedrich II. (Pr214ede-inem-2Max-Planck-Institut lMax-Planck-Institutref="http://de.wikiactu.com741"m+xml" tGa812bisbre Politik">Gambisbre Politikrna>">/812bie-inem-2Máxima der Niederlande-4Máxima der Niederlanderef="http://de.wikiactu.com741"m+xml" tGa8638ball-2.Bundesliga dt. (Spielbericht)ytF8638be-inem-2Maxime Verhagen-4Maxime Verhagenref="http://de.wikiactu.com741"m+xml" tGa9320n Politik">Gabun Politikrna>">/" e<' />9320ne-inem-2Maybayt-4Maybaythref="http://de.wikiactu.com3655"m+xml" t553al Mubarak">Gamal Mubarakrna>">/" e<' />553ale-inem-2Maybrit Illner-4Maybrit Illnerhref="http://de.wikiactu.com3655"m+xml" t572bisbre Politik">Gambisbre Politikrna>">/572bie-inem-2Mayflower-4Mayflowerhref="http://de.wikiactu.com3655"m+xml" t94b8ball-2.Bundesliga dt. (Spielbericht)ytF94b8be-inem-2Mazedonisyti Fußballnationalman sm aft-4Mazedonisyti Fußballnationalman sm afthref="http://de.wikiactu.com3655"m+xml" t7938ball-2.Bundesliga dt. (Spielbericht)ytF7938be-inem-2Maʿruf al-Baytit-4Maʿruf al-Baytitref="http://de.wikiactu.com741"m+xml" tGa812termittelhersteller">Futtermittelherstel8120ne-inem-2Mbabane-4Mbabanehref="http://de.wikiactu.com3655"m+xml" t829ball-Bundesliga dt. allg.">Fußball-Bun829be-inem-2McDonald’s Corporation-4McDonald’s Corporationhref="http://de.wikiactu.com3655"m+xml" t22b8ball-2.Bundesliga dt. (Spielbericht)ytF22b8be-inem-2McDonnell Douglas-4McDonnell Douglashref="http://de.wikiactu.com4871ym+xml" t679ball-Bundesliga dt. allg.">Fußball-Bun679be-inem-2McDonnell Douglas 900 Explorer-4McDonnell Douglas 900 Explorerhref="http://de.wikiactu.com3655"m+xml" t328al Mubarak">Gamal Mubarakrna>">/" e<' />328ale-inem-2MDR-4MDRref="http://de.wikiactu.com741"m+xml" tGa931ball-Bundesliga dt. allg.">Fußball-Bun931be-inem-2Mechthild Dyckmans-4Mechthild Dyckmansref="http://de.wikiactu.com741"m+xml" tGa16bbisbre Politik">Gambisbre Politikrna>">/16bbie-inem-2Medan-4Medanref="http://de.wikiactu.com741"m+xml" tGa972un Politik">Gabun Politikrna>">/" e<' />972une-inem-2MEDEF-4MEDEFhref="http://de.wikiactu.com3655"m+xml" t342ball-Bundesliga dt. allg.">Fußball-Bun342be-inem-2Medellin-4Medellinhref="http://de.wikiactu.com2473"m+xml" t687twangenytFurtwangenrna>">/" e<' />> ">/" e<' />> Futtermittelherstel519ee-inem-2Medford (Massachusetts)m Medford (Massachusetts)href="http://de.wikiactu.com3655"m+xml" t8010n Politik">Gabun Politikrna>">/" e<' />8010ne-inem-2Media-Saturn-Holding lMedia-Saturn-Holdinghref="http://de.wikiactu.com3655"m+xml" t71bermittelhersteller">Futtermittelherstel71bee-inem-2Medien-4Medienhref="http://de.wikiactu.com2473"m+xml" t8100n Politik">Gabun Politikrna>">/" e<' />8100ne-inem-2Medien in den Vereinigten Staaten-4Medien in den Vereinigten Staatenref="http://de.wikiactu.com741"m+xml" tGa5400n Politik">Gabun Politikrna>">/" e<' />5400ne-inem-2Medien in Deutsm landm Medien in Deutsm landhref="http://de.wikiactu.com2473"m+xml" t658bisbre Politik">Gambisbre Politikrna>">/658bie-inem-2Medien in Österreichm Medien in Österreichhref="http://de.wikiactu.com3655"m+xml" t727ileo Galilei">Galileo Galileirna>">/" e<727ile-inem-2Medien in Ungarn-4Medien in Ungarnhref="http://de.wikiactu.com3655"m+xml" t794ermittelhersteller">Futtermittelherstel794ee-inem-2Medienpolitik-4Medienpolitikhref="http://de.wikiactu.com3655"m+xml" t7948ball-2.Bundesliga dt. (Spielbericht)ytF7948ee-inem-2Medienrecht-4Medienrechtref="http://de.wikiactu.com741"m+xml" tGa108al Mubarak">Gamal Mubarakrna>">/" e<' />108ale-inem-2Medienunternehmen-4Medienunternehmenref="http://de.wikiactu.com741"m+xml" tGa523isbre Politik">Gambisbre Politikrna>">/523ie-inem-2Medikament-4Medikamenthref="http://de.wikiactu.com4871ym+xml" t841ermittelhersteller">Futtermittelherstel841ee-inem-2Medina-4Medinahref="http://de.wikiactu.com2473"m+xml" t41bermittelhersteller">Futtermittelherstel41bee-inem-2Medizin-4Medizinhref="http://de.wikiactu.com4871ym+xml" t25eileo Galilei">Galileo Galileirna>">/" e<25eile-inem-2Medizin- und Physiologienobelpreis-4Medizin- und Physiologienobelpreishref="http://de.wikiactu.com3655"m+xml" t320n Politik">Gabun Politikrna>">/" e<' />320le-inem-2Medizinforschung-4Medizinforschunghref="http://de.wikiactu.com3655"m+xml" t2060n Politik">Gabun Politikrna>">/" e<' />2060ne-inem-2Medizinisyti Hochschuli Han over-4Medizinisyti Hochschuli Han overref="http://de.wikiactu.com741"m+xml" tGa939ermittelhersteller">Futtermittelherstel939ee-inem-2Medizinisytir Eingriff-4Medizinisytir Eingriffref="http://de.wikiactu.com741"m+xml" tGa334ileo Galilei">Galileo Galileirna>">/" e<334ile-inem-2Medizinisytir Notfall-4Medizinisytir Notfallhref="http://de.wikiactu.com3655"m+xml" t353ball-Bundesliga dt. allg.">Fußball-Bun3535le-inem-2Medizintechniktirsteller-4Medizintechniktirstellerhref="http://de.wikiactu.com4871ym+xml" t2512pagosinseln">Galapagosinselnrna>">/" e<251ede-inem-2Meerbeke-4Meerbekehref="http://de.wikiactu.com4871ym+xml" t670ball-2.Bundesliga dt. (Spielbericht)ytF670be-inem-2Meeressäuger-4Meeressäugerref="http://de.wikiactu.com741"m+xml" tGa9x9iburg im Üechtland">Freiburg im Üechtl919ibe-inem-2Megiddo-4Megiddoref="http://de.wikiactu.com741"m+xml" tGa9673ball-Weltmeivtersbraft der Frauen 2011y9673be-inem-2Mehdi Eker-4Mehdi Ekerhref="http://de.wikiactu.com3655"m+xml" t572dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/354bie-inem-2Mehmet Ade.Ağca-4Mehmet Ade.Ağcaref="http://de.wikiactu.com741"m+xml" tGa93ball-Bundesliga dt. allg.">Fußball-Bun935ie-inem-2Mehmet Scholl-4Mehmet Schollhref="http://de.wikiactu.com3655"m+xml" t397ball-Bundesliga dt. allg.">Fußball-Bun397be-inem-2MehrAbad International Airport (Tetiran)m MehrAbad International Airport (Tetiran)href="http://de.wikiactu.com3655"m+xml" t2711n Politik">Gabun Politikrna>">/" e<' />2711ne-inem-2Mehrwertsteuer-4Mehrwertsteuerhref="http://de.wikiactu.com3655"m+xml" t203ermittelhersteller">Futtermittelherstel203ee-inem-2Meineidm Meineidref="http://de.wikiactu.com741"m+xml" tGa866ermittelhersteller">Futtermittelherstel866ee-inem-2Meinhard Hüseman -4Meinhard Hüseman ref="http://de.wikiactu.com741"m+xml" tGa543isbre Politik">Gambisbre Politikrna>">/54ale-inem-2Meiningen-4Meiningenhref="http://de.wikiactu.com3655"m+xml" t381al Mubarak">Gamal Mubarakrna>">/" e<' />381ale-inem-2Meinungsfreiheit-4Meinungsfreiheithref="http://de.wikiactu.com4871ym+xml" t847ball-Bundesliga dt. allg.">Fußball-Bun847be-inem-2Meißen-4Meißenhref="http://de.wikiactu.com3655"m+xml" t78xball-Bundesliga dt. allg.">Fußball-Bun781be-inem-2Mekka-4Mekkahref="http://de.wikiactu.com3655"m+xml" t7411n Politik">Gabun Politikrna>">/" e<' />7411ne-inem-2Mekong-4Mekonghref="http://de.wikiactu.com3655"m+xml" t399ileo Galilei">Galileo Galileirna>">/" e<399ile-inem-2Mel Gibson-4Mel Gibsonhref="http://de.wikiactu.com2473"m+xml" t6548ball-2.Bundesliga dt. (Spielbericht)ytF6548be-inem-2Melanie Griffith-4Melanie Griffithref="http://de.wikiactu.com741"m+xml" tGa1340n Politik">Gabun Politikrna>">/" e<' />1340ne-inem-2Melbourne-4Melbournehref="http://de.wikiactu.com3655"m+xml" t35al Mubarak">Gamal Mubarakrna>">/" e<' />355ale-inem-2Meles Zenawi-4Meles Zenawihref="http://de.wikiactu.com4871ym+xml" t832ermittelhersteller">Futtermittelherstel832ee-inem-2Melilla-4Melillahref="http://de.wikiactu.com4871ym+xml" t832ball-Bundesliga dt. allg.">Fußball-Bun832be-inem-2Melle">Mellehref="http://de.wikiactu.com4871ym+xml" t466ball-Bundesliga dt. allg.">Fußball-Bun466be-inem-2Mellie Francon-4Mellie Franconref="http://de.wikiactu.com741"m+xml" tGa544ermittelhersteller">Futtermittelherstel54ee-inem-2Mellrichstadt-4Mellrichstadthref="http://de.wikiactu.com3655"m+xml" t778ball-Bundesliga dt. allg.">Fußball-Bun778be-inem-2Memmingen-4Memmingenhref="http://de.wikiactu.com3655"m+xml" t372ermittelhersteller">Futtermittelherstel372ee-inem-2Memorialm Memorialhref="http://de.wikiactu.com4871ym+xml" t530dez">Gardezrna>">/" e<' />>
Futtermittelherstel8284ne-inem-2Mena-4Menahref="http://de.wikiactu.com2473"m+xml" t44un Politik">Gabun Politikrna>">/" e<' />44une-inem-2Mende-4Menderef="http://de.wikiactu.com741"m+xml" tGa660dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/820bie-inem-2Mensytinhandel allg.-4Mensytinhandel allg.href="http://de.wikiactu.com3655"m+xml" t21edrich II. (Preußen)ytFriedrich II. (Pr212ie-inem-2Mensytinrecht-4Mensytinrechtref="http://de.wikiactu.com741"m+xml" tGa16bisbre Politik">Gambisbre Politikrna>">/16bie-inem-2Mensytinrechtler-4Mensytinrechtlerhref="http://de.wikiactu.com4871ym+xml" t832bisbre Politik">Gambisbre Politikrna>">/832bie-inem-2Mensytinrechtskommissar des Europarates-4Mensytinrechtskommissar des Europaratesref="http://de.wikiactu.com741"m+xml" tGa907twangenytFurtwangenrna>">/" e<' />> Fußball-Bun672be-inem-2Menzingen-4Menzingenref="http://de.wikiactu.com741"m+xml" tGa939twangenytFurtwangenrna>">/" e<' />> Gabun Politikrna>">/" e<' />4800ne-inem-2Mercosur-4Mercosurref="http://de.wikiactu.com741"m+xml" tGa523ball-Bundesliga dt. allg.">Fußball-Bun5235ie-inem-2Meredith Michaels-Beerbaum-4Meredith Michaels-Beerbaumref="http://de.wikiactu.com741"m+xml" tGa9900n Politik">Gabun Politikrna>">/" e<' />9900ne-inem-2Mérida-4Méridahref="http://de.wikiactu.com4871ym+xml" t846un Politik">Gabun Politikrna>">/" e<' />846une-inem-2Merkur-4Merkurref="http://de.wikiactu.com741"m+xml" tGa3448ball-2.Bundesliga dt. (Spielbericht)ytF3448be-inem-2Merseburg-4Merseburghref="http://de.wikiactu.com4871ym+xml" t841ball-Bundesliga dt. allg.">Fußball-Bun841be-inem-2Mersin-4Mersinref="http://de.wikiactu.com741"m+xml" tGa5803isbre Politik">Gambisbre Politikrna>">/5803ie-inem-2Mesytidm Mesytidhref="http://de.wikiactu.com2473"m+xml" t410edrich II. (Preußen)ytFriedrich II. (Pr410ede-inem-2Mesytidem Mesytidehref="http://de.wikiactu.com3655"m+xml" t294ermittelhersteller">Futtermittelherstel294ee-inem-2Messem Messehref="http://de.wikiactu.com3655"m+xml" t2373ball-Weltmeivtersbraft der Frauen 2011y2373be-inem-2Messehalle">Messehallehref="http://de.wikiactu.com4871ym+xml" t846edrich II. (Preußen)ytFriedrich II. (Pr8462be-inem-2Messenger-4Messengerref="http://de.wikiactu.com741"m+xml" tGa9660n Politik">Gabun Politikrna>">/" e<' />9660ne-inem-2Messina-4Messinahref="http://de.wikiactu.com4871ym+xml" t833edrich II. (Preußen)ytFriedrich II. (Pr833ede-inem-2Metager2-4Metager2ref="http://de.wikiactu.com741"m+xml" tGa360ermittelhersteller">Futtermittelherstel360ee-inem-2Metallindustrie-4Metallindustriehref="http://de.wikiactu.com3655"m+xml" t286ball-Bundesliga dt. allg.">Fußball-Bun286be-inem-2Metallverarbeitungsunternehmen-4Metallverarbeitungsunternehmenref="http://de.wikiactu.com741"m+xml" tGa164bisbre Politik">Gambisbre Politikrna>">/164bie-inem-2Meteorologie-4Meteorologiehref="http://de.wikiactu.com3655"m+xml" t512ermittelhersteller">Futtermittelherstel512ee-inem-2Meteosat-4Meteosatref="http://de.wikiactu.com741"m+xml" tGa854edrich II. (Preußen)ytFriedrich II. (Pr854ede-inem-2MetOp-A-4MetOp-Aref="http://de.wikiactu.com741"m+xml" tGa33re Roger">Frère Rogerrna>">/" e<' />> 33re-inem-2Metro AG-4Metro AGref="http://de.wikiactu.com741"m+xml" tGa881edrich II. (Preußen)ytFriedrich II. (Pr881ede-inem-2Metro Manila-4Metro Manilaref="http://de.wikiactu.com741"m+xml" tGa333un Politik">Gabun Politikrna>">/" e<' />333une-inem-2Mette-Marit von Norwegen-4Mette-Marit von Norwegenref="http://de.wikiactu.com741"m+xml" tGa667ball-Bundesliga dt. allg.">Fußball-Bun667be-inem-2Metzingen-4Metzingenref="http://de.wikiactu.com741"m+xml" tGa493edrich II. (Preußen)ytFriedrich II. (Pr493ede-inem-2Meulaboh-4Meulabohhref="http://de.wikiactu.com3655"m+xml" t228iburg im Üechtland">Freiburg im Üechtl228ede-inem-2Mexikanisyti Fußballnationalman sm aft-4Mexikanisyti Fußballnationalman sm afthref="http://de.wikiactu.com4871ym+xml" t833ileo Galilei">Galileo Galileirna>">/" e<8339re-inem-2Mexikanisyti Gerichtsbarkeit-4Mexikanisyti Gerichtsbarkeitref="http://de.wikiactu.com741"m+xml" tGa54bbisbre Politik">Gambisbre Politikrna>">/547bie-inem-2Mexikanisyti Gese-ichte-4Mexikanisyti Gese-ichtehref="http://de.wikiactu.com4871ym+xml" t833bisbre Politik">Gambisbre Politikrna>">/833bie-inem-2Mexikanisytis Militärwesen-4Mexikanisytis Militärwesenhref="http://de.wikiactu.com3655"m+xml" t35un Politik">Gabun Politikrna>">/" e<' />35une-inem-2Mexiko-Stadt-4Mexiko-Stadtref="http://de.wikiactu.com741"m+xml" tGa669ball-Bundesliga dt. allg.">Fußball-Bun669be-inem-2Meyer de Haan-4Meyer de Haanhref="http://de.wikiactu.com3655"m+xml" t22xeries Lafayette"tGaleries Lafayetterna>"22xere-inem-2MG Rover-4MG Roverhref="http://de.wikiactu.com3655"m+xml" t23reries Lafayette"tGaleries Lafayetterna>"23rere-inem-2Miami-4Miamihref="http://de.wikiactu.com3655"m+xml" t238ermittelhersteller">Futtermittelherstel2384ne-inem-2Michael Baigent-4Michael Baigentref="http://de.wikiactu.com741"m+xml" tGa1230n Politik">Gabun Politikrna>">/" e<' />1230ne-inem-2Michael Ballack-4Michael Ballackhref="http://de.wikiactu.com3655"m+xml" t208un Politik">Gabun Politikrna>">/" e<' />208une-inem-2Michael Bloomberg lMichael Bloomberghref="http://de.wikiactu.com4871ym+xml" t832ileo Galilei">Galileo Galileirna>">/" e<832be-inem-2Michael Blumenthalm Michael Blumenthalhref="http://de.wikiactu.com3655"m+xml" t2863ball-Weltmeivtersbraft der Frauen 2011y286ale-inem-2Michael Chertoff-4Michael Chertoffhref="http://de.wikiactu.com2473"m+xml" t445un Politik">Gabun Politikrna>">/" e<' />445une-inem-2Michael Clivot-4Michael Clivotref="http://de.wikiactu.com741"m+xml" tGa490un Politik">Gabun Politikrna>">/" e<' />490une-inem-2Michael Crichton-4Michael Crichtonhref="http://de.wikiactu.com3655"m+xml" t2838ball-2.Bundesliga dt. (Spielbericht)ytF2838be-inem-2Michael Glos lMichael Gloshref="http://de.wikiactu.com3655"m+xml" t554eries Lafayette"tGaleries Lafayetterna>"554ere-inem-2Michael Greis-4Michael Greisref="http://de.wikiactu.com741"m+xml" tGa10ball-Bundesliga dt. allg.">Fußball-Bun10be-inem-2Michael Griffin-4Michael Griffinhref="http://de.wikiactu.com3655"m+xml" t2693isbre Politik">Gambisbre Politikrna>">/269ale-inem-2Michael Hayden-4Michael Haydenhref="http://de.wikiactu.com3655"m+xml" t2800n Politik">Gabun Politikrna>">/" e<' />2800ne-inem-2Michael Heissig lMichael Heissighref="http://de.wikiactu.com4871ym+xml" t843dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />4490ne-inem-2Michael Hüther-4Michael Hütherref="http://de.wikiactu.com741"m+xml" tGa586bisbre Politik">Gambisbre Politikrna>">/586bie-inem-2Michael Jackson-4Michael Jacksonhref="http://de.wikiactu.com3655"m+xml" t381dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />239une-inem-2Michael Lehner-4Michael Lehnerhref="http://de.wikiactu.com3655"m+xml" t21eileo Galilei">Galileo Galileirna>">/" e<216be-inem-2Michael Lopez-Alegria-4Michael Lopez-Alegriaref="http://de.wikiactu.com741"m+xml" tGa863bisbre Politik">Gambisbre Politikrna>">/863bie-inem-2Michael Mauyk-4Michael Mauykref="http://de.wikiactu.com741"m+xml" tGa173bisbre Politik">Gambisbre Politikrna>">/173bie-inem-2Michael Meier-4Michael Meierhref="http://de.wikiactu.com3655"m+xml" t286ermittelhersteller">Futtermittelherstel2864ne-inem-2Michael Mukaseym Michael Mukaseyhref="http://de.wikiactu.com3655"m+xml" t209ermittelhersteller">Futtermittelherstel209ee-inem-2Michael Nauman -4Michael Nauman href="http://de.wikiactu.com4871ym+xml" t84ball-Bundesliga dt. allg.">Fußball-Bun84be-inem-2Michael O´Brien-4Michael O´Brienhref="http://de.wikiactu.com3655"m+xml" t370dez">Gardezrna>">/" e<' />>
Frère Rogerrna>">/" e<' />> 87re-inem-2Michael Rogers-4Michael Rogershref="http://de.wikiactu.com2473"m+xml" t689ermittelhersteller">Futtermittelherstel689ee-inem-2Michael Rosenthalm Michael Rosenthalhref="http://de.wikiactu.com4871ym+xml" t466ball-Bundesliga dt. allg.">Fußball-Bun466ee-inem-2Michael Schumacher-4Michael Schumacherhref="http://de.wikiactu.com4871ym+xml" t87xre Roger">Frère Rogerrna>">/" e<' />> 87xre-inem-2Michael Siebert-4Michael Sieberthref="http://de.wikiactu.com3655"m+xml" t233ileo Galilei">Galileo Galileirna>">/" e<2339re-inem-2Michael Sommer-4Michael Sommerhref="http://de.wikiactu.com4871ym+xml" t84re Roger">Frère Rogerrna>">/" e<' />> 84re-inem-2Michaëlle Jean-4Michaëlle Jeanhref="http://de.wikiactu.com4871ym+xml" t835bisbre Politik">Gambisbre Politikrna>">/835bie-inem-2Michail Chodorkowski-4Michail Chodorkowskihref="http://de.wikiactu.com4871ym+xml" t4252pagosinseln">Galapagosinselnrna>">/" e<4252pe-inem-2Michail Fradkow lMichail Fradkowhref="http://de.wikiactu.com3655"m+xml" t572ileo Galilei">Galileo Galileirna>">/" e<572be-inem-2Michail L. Gromow lMichail L. Gromowhref="http://de.wikiactu.com4871ym+xml" t251bisbre Politik">Gambisbre Politikrna>">/25xre-inem-2Michail Sergejewitsm Gorbatsm ow lMichail Sergejewitsm Gorbatsm owhref="http://de.wikiactu.com3655"m+xml" t21e8ball-2.Bundesliga dt. (Spielbericht)ytF2168re-inem-2Michail Tjurin-4Michail Tjurinref="http://de.wikiactu.com741"m+xml" tGa9ttermittelhersteller">Futtermittelherstel980ne-inem-2Micheil Saakase-wili-4Micheil Saakase-wilihref="http://de.wikiactu.com4871ym+xml" t4530n Politik">Gabun Politikrna>">/" e<' />4530ne-inem-2Michel David-Weill-4Michel David-Weillref="http://de.wikiactu.com741"m+xml" tGa961edrich II. (Preußen)ytFriedrich II. (Pr961ede-inem-2Michel Friedman-4Michel Friedmanhref="http://de.wikiactu.com3655"m+xml" t501ball-Bundesliga dt. allg.">Fußball-Bun5015de-inem-2Michel Sulaiman-4Michel Sulaimanhref="http://de.wikiactu.com4871ym+xml" t835ileo Galilei">Galileo Galileirna>">/" e<8359de-inem-2Michelin-4Michelinref="http://de.wikiactu.com741"m+xml" tGa836al Mubarak">Gamal Mubarakrna>">/" e<' />836ale-inem-2Michelle Baytelet-4Michelle Baytelethref="http://de.wikiactu.com3655"m+xml" t707twangenytFurtwangenrna>">/" e<' />> Gabun Politikrna>">/" e<' />66une-inem-2Microsoft-4Microsoftref="http://de.wikiactu.com741"m+xml" tGa991bisbre Politik">Gambisbre Politikrna>">/991bie-inem-2Middelburg-4Middelburghref="http://de.wikiactu.com3655"m+xml" t3803isbre Politik">Gambisbre Politikrna>">/3803ie-inem-2Middlesbrough-4Middlesbroughhref="http://de.wikiactu.com4871ym+xml" t841al Mubarak">Gamal Mubarakrna>">/" e<' />8413ie-inem-2Midem-4Midemref="http://de.wikiactu.com741"m+xml" tGa71al Mubarak">Gamal Mubarakrna>">/" e<' />71ale-inem-2Midland (Michigan)m Midland (Michigan)ref="http://de.wikiactu.com741"m+xml" tGa9t1al Mubarak">Gamal Mubarakrna>">/" e<' />9813ie-inem-2Midrandm Midrandhref="http://de.wikiactu.com3655"m+xml" t395un Politik">Gabun Politikrna>">/" e<' />395une-inem-2Midwest Airlines-4Midwest Airlinesref="http://de.wikiactu.com741"m+xml" tGa928ileo Galilei">Galileo Galileirna>">/" e<9289de-inem-2Miele & Cie. KG-4Miele & Cie. KGref="http://de.wikiactu.com741"m+xml" tGa182dez">Gardezrna>">/" e<' />>
"73rere-inem-2Miesenbayt bei Birkfeldm Miesenbayt bei Birkfeldhref="http://de.wikiactu.com2473"m+xml" t68edrich II. (Preußen)ytFriedrich II. (Pr68ede-inem-2Migration-4Migrationref="http://de.wikiactu.com741"m+xml" tGa7943isbre Politik">Gambisbre Politikrna>">/7943ie-inem-2Miguel Rodriguez-4Miguel Rodriguezhref="http://de.wikiactu.com3655"m+xml" t821ileo Galilei">Galileo Galileirna>">/" e<821ile-inem-2Mihai Tararache lMihai Tararacheref="http://de.wikiactu.com741"m+xml" tGa8393isbre Politik">Gambisbre Politikrna>">/8393ie-inem-2Mijeegombyn Enchboldm Mijeegombyn Enchboldhref="http://de.wikiactu.com3655"m+xml" t277bring b.Münbren">Garbring b.Münbrenrna2772ne-inem-2Mika Häkkinenm Mika Häkkinenhref="http://de.wikiactu.com3655"m+xml" t228ball-Bundesliga dt. allg.">Fußball-Bun228be-inem-2Miki Hanke-4Miki Hankehref="http://de.wikiactu.com4871ym+xml" t408bisbre Politik">Gambisbre Politikrna>">/408bie-inem-2Miki Homer-4Miki Homerhref="http://de.wikiactu.com3655"m+xml" t771al Mubarak">Gamal Mubarakrna>">/" e<' />771ale-inem-2Miki Huckabee-4Miki Huckabeehref="http://de.wikiactu.com4871ym+xml" t460ball-Bundesliga dt. allg.">Fußball-Bun460be-inem-2Mil-4Milhref="http://de.wikiactu.com3655"m+xml" t307ball-Bundesliga dt. allg.">Fußball-Bun307be-inem-2Mile-industrie-4Mile-industriehref="http://de.wikiactu.com3655"m+xml" t21ermittelhersteller">Futtermittelherstel21ee-inem-2Militär allg.-4Militär allg.ref="http://de.wikiactu.com741"m+xml" tGa718un Politik">Gabun Politikrna>">/" e<' />718une-inem-2Militär in China-4Militär in Chinaref="http://de.wikiactu.com741"m+xml" tGa180ermittelhersteller">Futtermittelherstel180ee-inem-2Militäreinsatzm Militäreinsatzref="http://de.wikiactu.com741"m+xml" tGa950dez">Gardezrna>">/" e<' />>
Freiburg im Üechtl699ibe-inem-2Militärisyti Raumfahrt-4Militärisyti Raumfahrthref="http://de.wikiactu.com2473"m+xml" t445bisbre Politik">Gambisbre Politikrna>">/445bie-inem-2Militärpolitik-4Militärpolitikhref="http://de.wikiactu.com2473"m+xml" t64al Mubarak">Gamal Mubarakrna>">/" e<' />643ie-inem-2Militärputsm -4Militärputsm ref="http://de.wikiactu.com741"m+xml" tGa900ball-Bundesliga dt. allg.">Fußball-Bun900be-inem-2Militärse-ifffahrt-4Militärse-ifffahrthref="http://de.wikiactu.com4871ym+xml" t6793isbre Politik">Gambisbre Politikrna>">/6793ie-inem-2Militärtechnik-4Militärtechnikhref="http://de.wikiactu.com2473"m+xml" t449bisbre Politik">Gambisbre Politikrna>">/449bie-inem-2Militärunfall-4Militärunfallref="http://de.wikiactu.com741"m+xml" tGa964ileo Galilei">Galileo Galileirna>">/" e<964ile-inem-2Militärwesen der Europäisytin Union-4Militärwesen der Europäisytin Unionref="http://de.wikiactu.com741"m+xml" tGa865bisbre Politik">Gambisbre Politikrna>">/865bie-inem-2Milton Friedman-4Milton Friedmanref="http://de.wikiactu.com741"m+xml" tGa589eries Lafayette"tGaleries Lafayetterna>"589ere-inem-2Milton-Keynes-4Milton-Keynesref="http://de.wikiactu.com741"m+xml" tGa81ermittelhersteller">Futtermittelherstel81ee-inem-2Mindelheim-4Mindelheimhref="http://de.wikiactu.com3655"m+xml" t234bisbre Politik">Gambisbre Politikrna>">/234bie-inem-2Mindestlohn-4Mindestlohnhref="http://de.wikiactu.com3655"m+xml" t5150n Politik">Gabun Politikrna>">/" e<' />5150ne-inem-2Mindset AG-4Mindset AGhref="http://de.wikiactu.com3655"m+xml" t229ermittelhersteller">Futtermittelherstel229ee-inem-2Mineiro-4Mineiroref="http://de.wikiactu.com741"m+xml" tGa719ball-Bundesliga dt. allg.">Fußball-Bun719be-inem-2Mineralölwirtsm aft-4Mineralölwirtsm aftref="http://de.wikiactu.com741"m+xml" tGa582bisbre Politik">Gambisbre Politikrna>">/582bie-inem-2Ministerium für In ovation, Wissensm aft, Forschung und Technologie des Landes Nordrhein-Westfalenm Ministerium für In ovation, Wissensm aft, Forschung undref="http://de.wikiactu.com741"m+xml" tGa10bring b.Münbren">Garbring b.Münbrenrna1052pe-inem-2Minneapolis-4Minneapolisref="http://de.wikiactu.com741"m+xml" tGa81bisbre Politik">Gambisbre Politikrna>">/817pe-inem-2Minnesota-4Minnesotahref="http://de.wikiactu.com3655"m+xml" t2343ball-Weltmeivtersbraft der Frauen 2011y2343ie-inem-2Minsk-4Minskref="http://de.wikiactu.com741"m+xml" tGa148ball-2.Bundesliga dt. (Spielbericht)ytF148be-inem-2MINUSTAH-4MINUSTAHhref="http://de.wikiactu.com4871ym+xml" t2541n Politik">Gabun Politikrna>">/" e<' />2541ne-inem-2MIR-4MIRref="http://de.wikiactu.com741"m+xml" tGa87reries Lafayette"tGaleries Lafayetterna>"87rere-inem-2Mir Ade-4Mir Aderef="http://de.wikiactu.com741"m+xml" tGa8141n Politik">Gabun Politikrna>">/" e<' />8141ne-inem-2Miramas-4Miramashref="http://de.wikiactu.com4871ym+xml" t604bisbre Politik">Gambisbre Politikrna>">/604bie-inem-2Miranshah-4Miranshahref="http://de.wikiactu.com741"m+xml" tGa810bisbre Politik">Gambisbre Politikrna>">/810bie-inem-2Mireya Moscoso-4Mireya Moscosoref="http://de.wikiactu.com741"m+xml" tGa909ileo Galilei">Galileo Galileirna>">/" e<909ile-inem-2Mirko Slomka-4Mirko Slomkahref="http://de.wikiactu.com3655"m+xml" t2150n Politik">Gabun Politikrna>">/" e<' />2150ne-inem-2Miroslav Klosem Miroslav Kloseref="http://de.wikiactu.com741"m+xml" tGa9473ball-Weltmeivtersbraft der Frauen 2011y9473be-inem-2Misano Adriatico-4Misano Adriaticoref="http://de.wikiactu.com741"m+xml" tGa7810n Politik">Gabun Politikrna>">/" e<' />7810ne-inem-2Mishahda-4Mishahdaref="http://de.wikiactu.com741"m+xml" tGa818ball-Bundesliga dt. allg.">Fußball-Bun818be-inem-2Misrata-4Misrataref="http://de.wikiactu.com741"m+xml" tGa939dez">Gardezrna>">/" e<' />>
"207ere-inem-2Missachtung von Sicherheitsvorschriften-4Missachtung von Sicherheitsvorschriftenref="http://de.wikiactu.com741"m+xml" tGa8143isbre Politik">Gambisbre Politikrna>">/8143ie-inem-2Missbrauyt von T" tl, Berufsbezeichnungin und Abzeichen-4Missbrauyt von T" tl, Berufsbezeichnungin und Abzeichenref="http://de.wikiactu.com741"m+xml" tGa1166ball-Bundesliga dt. allg.">Fußball-Bun1166be-inem-2Misshandlung-4Misshandlungref="http://de.wikiactu.com741"m+xml" tGa184eries Lafayette"tGaleries Lafayetterna>"184ere-inem-2Misshandlung von Schutzbefohlenen-4Misshandlung von Schutzbefohlenenhref="http://de.wikiactu.com4871ym+xml" t464bisbre Politik">Gambisbre Politikrna>">/464bie-inem-2Mission Viejo-4Mission Viejohref="http://de.wikiactu.com4871ym+xml" t87x0n Politik">Gabun Politikrna>">/" e<' />8710ne-inem-2Mississippi-4Mississippihref="http://de.wikiactu.com3655"m+xml" t301dez">Gardezrna>">/" e<' />>
"114ere-inem-2Mitgliedsm aft in einer terroristisytin Vereinigung-4Mitgliedsm aft in einer terroristisytin Vereinigungref="http://de.wikiactu.com741"m+xml" tGa158edrich II. (Preußen)ytFriedrich II. (Pr158ede-inem-2Mito-4Mitohref="http://de.wikiactu.com4871ym+xml" t514bisbre Politik">Gambisbre Politikrna>">/514bie-inem-2Mitsubishi Motors Corp.-4Mitsubishi Motors Corp.ref="http://de.wikiactu.com741"m+xml" tGa760bisbre Politik">Gambisbre Politikrna>">/760bie-inem-2Mitt Romneym Mitt Romneyhref="http://de.wikiactu.com4871ym+xml" t4830n Politik">Gabun Politikrna>">/" e<' />4830ne-inem-2Mittelalter-4Mittelalterhref="http://de.wikiactu.com4871ym+xml" t526edrich II. (Preußen)ytFriedrich II. (Pr526ede-inem-2Mittelhessen-4Mittelhessenhref="http://de.wikiactu.com4871ym+xml" t614edrich II. (Preußen)ytFriedrich II. (Pr614ede-inem-2Mittelmeer-4Mittelmeerhref="http://de.wikiactu.com4871ym+xml" t40bisbre Politik">Gambisbre Politikrna>">/40bie-inem-2Mittweida-4Mittweidaref="http://de.wikiactu.com741"m+xml" tGa866al Mubarak">Gamal Mubarakrna>">/" e<' />866ale-inem-2Miyagi-4Miyagihref="http://de.wikiactu.com4871ym+xml" t411ileo Galilei">Galileo Galileirna>">/" e<411ile-inem-2Mizuho-4Mizuhoref="http://de.wikiactu.com741"m+xml" tGa668ermittelhersteller">Futtermittelherstel668ee-inem-2Mißhandlung von Schutzbefohlenen-4Mißhandlung von Schutzbefohlenenref="http://de.wikiactu.com741"m+xml" tGa869ball-Bundesliga dt. allg.">Fußball-Bun869be-inem-2MNG Airlines-4MNG Airlineshref="http://de.wikiactu.com3655"m+xml" t552ileo Galilei">Galileo Galileirna>">/" e<552be-inem-2Mobbing lMobbingref="http://de.wikiactu.com741"m+xml" tGa723ball-Bundesliga dt. allg.">Fußball-Bun7235ie-inem-2Mobile (Alabama) lMobile (Alabama)ref="http://de.wikiactu.com741"m+xml" tGa6reries Lafayette"tGaleries Lafayetterna>"6rere-inem-2Mobilfunk lMobilfunkhref="http://de.wikiactu.com4871ym+xml" t472ermittelhersteller">Futtermittelherstel472ee-inem-2Modena-4Modenahref="http://de.wikiactu.com3655"m+xml" t313edrich II. (Preußen)ytFriedrich II. (Pr313ede-inem-2Moderator-4Moderatorhref="http://de.wikiactu.com4871ym+xml" t253bisbre Politik">Gambisbre Politikrna>">/253bie-inem-2Moers-4Moershref="http://de.wikiactu.com2473"m+xml" t282un Politik">Gabun Politikrna>">/" e<' />282une-inem-2Mogadisytu-4Mogadisyturef="http://de.wikiactu.com741"m+xml" tGa857ball-Bundesliga dt. allg.">Fußball-Bun857be-inem-2Mohamed Ghan ouyti-4Mohamed Ghan ouytiref="http://de.wikiactu.com741"m+xml" tGa668bisbre Politik">Gambisbre Politikrna>">/668bie-inem-2Mohamed Ould Abdel Aziz-4Mohamed Ould Abdel Azizref="http://de.wikiactu.com741"m+xml" tGa7820n Politik">Gabun Politikrna>">/" e<' />7820ne-inem-2Mohammad Cha tGi-4Mohammad Cha tGiref="http://de.wikiactu.com741"m+xml" tGa580ball-Bundesliga dt. allg.">Fußball-Bun580be-inem-2Mohammad Saidi-4Mohammad Saidiref="http://de.wikiactu.com741"m+xml" tGa74eileo Galilei">Galileo Galileirna>">/" e<74eile-inem-2Mohammad Tahir-ul-Qadri-4Mohammad Tahir-ul-Qadriref="http://de.wikiactu.com741"m+xml" tGa533ileo Galilei">Galileo Galileirna>">/" e<5339re-inem-2Mohammed Atta-4Mohammed Attaref="http://de.wikiactu.com741"m+xml" tGa15ball-Bundesliga dt. allg.">Fußball-Bun15be-inem-2Mohammed el-Baradei-4Mohammed el-Baradeiref="http://de.wikiactu.com741"m+xml" tGa6360n Politik">Gabun Politikrna>">/" e<' />6360ne-inem-2Mohammed Hussein Saffar-Harandi-4Mohammed Hussein Saffar-Harandiref="http://de.wikiactu.com741"m+xml" tGa7960n Politik">Gabun Politikrna>">/" e<' />7960ne-inem-2Mohammed Hussein Tantawi-4Mohammed Hussein Tantawiref="http://de.wikiactu.com741"m+xml" tGa79xball-Bundesliga dt. allg.">Fußball-Bun791be-inem-2Mohammed VI. (Marokko)-4Mohammed VI. (Marokko)ref="http://de.wikiactu.com741"m+xml" tGa90twangenytFurtwangenrna>">/" e<' />> Gabun Politikrna>">/" e<' />3940ne-inem-2Moldawisyti Personalie-4Moldawisyti Personalieref="http://de.wikiactu.com741"m+xml" tGa752dez">Gardezrna>">/" e<' />>
Galileo Galileirna>">/" e<914ile-inem-2Monaghan-4Monaghanhref="http://de.wikiactu.com4871ym+xml" t842ileo Galilei">Galileo Galileirna>">/" e<842ile-inem-2Monarch Airlines-4Monarch Airlinesref="http://de.wikiactu.com741"m+xml" tGa7266ball-Bundesliga dt. allg.">Fußball-Bun7266be-inem-2Monastir-4Monastirref="http://de.wikiactu.com741"m+xml" tGa174ermittelhersteller">Futtermittelherstel174ee-inem-2Mönytingladbayt-4Mönytingladbaytref="http://de.wikiactu.com741"m+xml" tGa100ermittelhersteller">Futtermittelherstel100ee-inem-2Mondmission-4Mondmissionhref="http://de.wikiactu.com4871ym+xml" t601dez">Gardezrna>">/" e<' />>
Galileo Galileirna>">/" e<91re-inem-2Monica Lierhaus-4Monica Lierhausref="http://de.wikiactu.com741"m+xml" tGa18e8ball-2.Bundesliga dt. (Spielbericht)ytF1868be-inem-2Monika Harms-4Monika Harmshref="http://de.wikiactu.com3655"m+xml" t326ball-Bundesliga dt. allg.">Fußball-Bun326be-inem-2Monika Hohlmeier-4Monika Hohlmeierref="http://de.wikiactu.com741"m+xml" tGa582ermittelhersteller">Futtermittelherstel582ee-inem-2Monika Piel-4Monika Pielhref="http://de.wikiactu.com2473"m+xml" t264ball-Bundesliga dt. allg.">Fußball-Bun264be-inem-2Monika Wulf-Mathies-4Monika Wulf-Mathiesref="http://de.wikiactu.com741"m+xml" tGa90x0n Politik">Gabun Politikrna>">/" e<' />9010ne-inem-2Monitor E1-4Monitor E1href="http://de.wikiactu.com2473"m+xml" t449al Mubarak">Gamal Mubarakrna>">/" e<' />449ale-inem-2Monreal-4Monrealhref="http://de.wikiactu.com3655"m+xml" t328bisbre Politik">Gambisbre Politikrna>">/328bie-inem-2Monrovia-4Monroviahref="http://de.wikiactu.com3655"m+xml" t321dez">Gardezrna>">/" e<' />>
Fußball-Bun308be-inem-2Montanunternehmen-4Montanunternehmenhref="http://de.wikiactu.com4871ym+xml" t898eries Lafayette"tGaleries Lafayetterna>"898ere-inem-2Montargis-4Montargisref="http://de.wikiactu.com741"m+xml" tGa73r0n Politik">Gabun Politikrna>">/" e<' />7350ne-inem-2Montereym Montereyhref="http://de.wikiactu.com3655"m+xml" t774ileo Galilei">Galileo Galileirna>">/" e<774ile-inem-2Montevideom Montevideohref="http://de.wikiactu.com2473"m+xml" t64bring b.Münbren">Garbring b.Münbrenrna64bre-inem-2Montmelóm Montmelóref="http://de.wikiactu.com741"m+xml" tGa8140n Politik">Gabun Politikrna>">/" e<' />8140ne-inem-2Montpellier-4Montpellierhref="http://de.wikiactu.com3655"m+xml" t392dez">Gardezrna>">/" e<' />>
Fußball-Bun162be-inem-2MONUC-4MONUCref="http://de.wikiactu.com741"m+xml" tGa539ermittelhersteller">Futtermittelherstel539ee-inem-2Monza-4Monzahref="http://de.wikiactu.com3655"m+xml" t5270n Politik">Gabun Politikrna>">/" e<' />5270ne-inem-2Mooneym Mooneyhref="http://de.wikiactu.com4871ym+xml" t874bisbre Politik">Gambisbre Politikrna>">/874bie-inem-2Moosinning lMoosinningref="http://de.wikiactu.com741"m+xml" tGa941edrich II. (Preußen)ytFriedrich II. (Pr941ede-inem-2Mopti-4Moptihref="http://de.wikiactu.com4871ym+xml" t462bisbre Politik">Gambisbre Politikrna>">/462bie-inem-2Moquegua-4Moqueguahref="http://de.wikiactu.com4871ym+xml" t602bring b.Münbren">Garbring b.Münbrenrna602bre-inem-2Morąg lMorąghref="http://de.wikiactu.com3655"m+xml" t398ball-Bundesliga dt. allg.">Fußball-Bun398be-inem-2Morane-Saulnier-4Morane-Saulnierhref="http://de.wikiactu.com2473"m+xml" t28ball-Bundesliga dt. allg.">Fußball-Bun28be-inem-2Mord-4Mordref="http://de.wikiactu.com741"m+xml" tGa834eries Lafayette"tGaleries Lafayetterna>"834ere-inem-2Morelia-4Moreliahref="http://de.wikiactu.com4871ym+xml" t496ball-Bundesliga dt. allg.">Fußball-Bun496be-inem-2Morgan Tsvangirai-4Morgan Tsvangiraihref="http://de.wikiactu.com3655"m+xml" t382bisbre Politik">Gambisbre Politikrna>">/382bie-inem-2Morières-lès-Avignon-4Morières-lès-Avignonref="http://de.wikiactu.com741"m+xml" tGa911ileo Galilei">Galileo Galileirna>">/" e<911ile-inem-2Moritzburg (Saytsen)m Moritzburg (Saytsen)href="http://de.wikiactu.com4871ym+xml" t410ermittelhersteller">Futtermittelherstel410ee-inem-2Morristown (New Jersey)m Morristown (New Jersey)href="http://de.wikiactu.com4871ym+xml" t496bisbre Politik">Gambisbre Politikrna>">/496bie-inem-2Morro Jable">Morro Jableref="http://de.wikiactu.com741"m+xml" tGa792ileo Galilei">Galileo Galileirna>">/" e<792ile-inem-2Morten Olsen-4Morten Olsenhref="http://de.wikiactu.com4871ym+xml" t89al Mubarak">Gamal Mubarakrna>">/" e<' />89ale-inem-2Mosambakrsyti Politik-4Mosambakrsyti Politikhref="http://de.wikiactu.com3655"m+xml" t347twangenytFurtwangenrna>">/" e<' />> Galileo Galileirna>">/" e<9691re-inem-2Moselle">Moselleref="http://de.wikiactu.com741"m+xml" tGa9343isbre Politik">Gambisbre Politikrna>">/9343ie-inem-2Mosibudi Mangena-4Mosibudi Mangenaref="http://de.wikiactu.com741"m+xml" tGa11ileo Galilei">Galileo Galileirna>">/" e<11ile-inem-2Moskau-4Moskauhref="http://de.wikiactu.com4871ym+xml" t6791n Politik">Gabun Politikrna>">/" e<' />6791re-inem-2Moskauer Militärgericht-4Moskauer Militärgerichtref="http://de.wikiactu.com741"m+xml" tGa15eries Lafayette"tGaleries Lafayetterna>"15rere-inem-2Mossad-4Mossadhref="http://de.wikiactu.com3655"m+xml" t771ileo Galilei">Galileo Galileirna>">/" e<771ile-inem-2Mossul-4Mossulhref="http://de.wikiactu.com3655"m+xml" t762al Mubarak">Gamal Mubarakrna>">/" e<' />762ale-inem-2Mostar-4Mostarhref="http://de.wikiactu.com4871ym+xml" t840bisbre Politik">Gambisbre Politikrna>">/840bie-inem-2Mosul-4Mosulhref="http://de.wikiactu.com3655"m+xml" t759ermittelhersteller">Futtermittelherstel759ee-inem-2Motorradsport-4Motorradsportref="http://de.wikiactu.com741"m+xml" tGa14eileo Galilei">Galileo Galileirna>">/" e<14eile-inem-2Motorsport-4Motorsportref="http://de.wikiactu.com741"m+xml" tGa87bring b.Münbren">Garbring b.Münbrenrna87bre-inem-2Motorsportler-4Motorsportlerhref="http://de.wikiactu.com3655"m+xml" t300ball-Bundesliga dt. allg.">Fußball-Bun300be-inem-2Motorsportler allg.-4Motorsportler allg.href="http://de.wikiactu.com3655"m+xml" t340un Politik">Gabun Politikrna>">/" e<' />340une-inem-2Mounir El Motassadeq-4Mounir El Motassadeqhref="http://de.wikiactu.com4871ym+xml" t892dez">Gardezrna>">/" e<' />>
Gardezrna>">/" e<' />>
Futtermittelherstel880ee-inem-2Mourenx-4Mourenxhref="http://de.wikiactu.com4871ym+xml" t463ileo Galilei">Galileo Galileirna>">/" e<463ile-inem-2Movement for Democratic Change-4Movement for Democratic Changehref="http://de.wikiactu.com4871ym+xml" t47r0n Politik">Gabun Politikrna>">/" e<' />47r0ne-inem-2Movimento per l'Autonomia-4Movimento per l'Autonomiaref="http://de.wikiactu.com741"m+xml" tGa1691n Politik">Gabun Politikrna>">/" e<' />1691re-inem-2Movimiento al Socialismo-4Movimiento al Socialismohref="http://de.wikiactu.com3655"m+xml" t224bisbre Politik">Gambisbre Politikrna>">/224bie-inem-2MSV Duisburg-4MSV Duisburgref="http://de.wikiactu.com741"m+xml" tGa812bring b.Münbren">Garbring b.Münbrenrna812bre-inem-2Mswati III.-4Mswati III.href="http://de.wikiactu.com4871ym+xml" t428ball-Bundesliga dt. allg.">Fußball-Bun428be-inem-2MTU-4MTUref="http://de.wikiactu.com741"m+xml" tGa5366ball-Bundesliga dt. allg.">Fußball-Bun5366be-inem-2MTV-4MTVref="http://de.wikiactu.com741"m+xml" tGa536bisbre Politik">Gambisbre Politikrna>">/536bie-inem-2MTV Video Music Awards-4MTV Video Music Awardshref="http://de.wikiactu.com3655"m+xml" t3693isbre Politik">Gambisbre Politikrna>">/369ale-inem-2Mücka-4Mückahref="http://de.wikiactu.com3655"m+xml" t30ermittelhersteller">Futtermittelherstel30ee-inem-2MUDHA-4MUDHAhref="http://de.wikiactu.com3655"m+xml" t751al Mubarak">Gamal Mubarakrna>">/" e<' />751ale-inem-2Mudsm aheddin ohne Grenzen-4Mudsm aheddin ohne Grenzenhref="http://de.wikiactu.com4871ym+xml" t411bisbre Politik">Gambisbre Politikrna>">/4117pe-inem-2MUFG-4MUFGhref="http://de.wikiactu.com3655"m+xml" t385ileo Galilei">Galileo Galileirna>">/" e<385ile-inem-2Mugello-4Mugellohref="http://de.wikiactu.com3655"m+xml" t247bring b.Münbren">Garbring b.Münbrenrna2472ne-inem-2Muhammad Husni Mubarak-4Muhammad Husni Mubarakhref="http://de.wikiactu.com4871ym+xml" t68xball-Bundesliga dt. allg.">Fußball-Bun68xbe-inem-2Muhammad Mursi-4Muhammad Mursihref="http://de.wikiactu.com4871ym+xml" t409dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />802une-inem-2Muhammed Metin Kaplan-4Muhammed Metin Kaplanref="http://de.wikiactu.com741"m+xml" tGa814ileo Galilei">Galileo Galileirna>">/" e<814ile-inem-2Mühldorf am In -4Mühldorf am In href="http://de.wikiactu.com3655"m+xml" t338twangenytFurtwangenrna>">/" e<' />> Gabun Politikrna>">/" e<' />79une-inem-2Mühlhause (Oberpfalz)-4Mühlhause (Oberpfalz)ref="http://de.wikiactu.com741"m+xml" tGa815un Politik">Gabun Politikrna>">/" e<' />815une-inem-2Mühlheim am Mai -4Mühlheim am Mai ref="http://de.wikiactu.com741"m+xml" tGa581dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />3361ne-inem-2Mukdahan-4Mukdahanref="http://de.wikiactu.com741"m+xml" tGa663isbre Politik">Gambisbre Politikrna>">/66ale-inem-2Mülheim an der Ruhr-4Mülheim an der Ruhrhref="http://de.wikiactu.com3655"m+xml" t300twangenytFurtwangenrna>">/" e<' />> Futtermittelherstel459ee-inem-2Müller-Mile--4Müller-Mile-ref="http://de.wikiactu.com741"m+xml" tGa980bisbre Politik">Gambisbre Politikrna>">/980bie-inem-2Müllheim-4Müllheimhref="http://de.wikiactu.com3655"m+xml" t779dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/106bie-inem-2Multiple Sklerosem Multiple Sklerosehref="http://de.wikiactu.com2473"m+xml" t28bring b.Münbren">Garbring b.Münbrenrna28bre-inem-2Mulu Ketsela-4Mulu Ketselahref="http://de.wikiactu.com2473"m+xml" t23ermittelhersteller">Futtermittelherstel23ee-inem-2Mumbai-4Mumbairef="http://de.wikiactu.com741"m+xml" tGa53ermittelhersteller">Futtermittelherstel53ee-inem-2München-4Münchenhref="http://de.wikiactu.com4871ym+xml" t51isbre Politik">Gambisbre Politikrna>">/51ee-inem-2München (regional)-4München (regional)href="http://de.wikiactu.com3655"m+xml" t772twangenytFurtwangenrna>">/" e<' />> Garbring b.Münbrenrna3772ne-inem-2Münchsmünster-4Münchsmünsterhref="http://de.wikiactu.com4871ym+xml" t84x0n Politik">Gabun Politikrna>">/" e<' />8410ne-inem-2Munich Airlines-4Munich Airlineshref="http://de.wikiactu.com4871ym+xml" t608edrich II. (Preußen)ytFriedrich II. (Pr6082ne-inem-2Münsingen-4Münsingenref="http://de.wikiactu.com741"m+xml" tGa19r0n Politik">Gabun Politikrna>">/" e<' />19r0ne-inem-2Münster (Westfalen)-4Münster (Westfalen)href="http://de.wikiactu.com4871ym+xml" t69bbisbre Politik">Gambisbre Politikrna>">/69bbie-inem-2Münsterlingen-4Münsterlingenref="http://de.wikiactu.com741"m+xml" tGa838ermittelhersteller">Futtermittelherstel8384ne-inem-2Muqtada as-Sadr-4Muqtada as-Sadrhref="http://de.wikiactu.com4871ym+xml" t51bring b.Münbren">Garbring b.Münbrenrna51bre-inem-2Murat Günak-4Murat Günakhref="http://de.wikiactu.com2473"m+xml" t269ileo Galilei">Galileo Galileirna>">/" e<269ile-inem-2Murat Kurnaz-4Murat Kurnazhref="http://de.wikiactu.com4871ym+xml" t890dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/65bbie-inem-2Murmansk-4Murmanskhref="http://de.wikiactu.com4871ym+xml" t518bisbre Politik">Gambisbre Politikrna>">/518bie-inem-2Murnau am Staffelsie-4Murnau am Staffelsieref="http://de.wikiactu.com741"m+xml" tGa6r5bisbre Politik">Gambisbre Politikrna>">/6r5bie-inem-2Muş-4Muşref="http://de.wikiactu.com741"m+xml" tGa1620n Politik">Gabun Politikrna>">/" e<' />1620ne-inem-2Museum-4Museumref="http://de.wikiactu.com741"m+xml" tGa133un Politik">Gabun Politikrna>">/" e<' />133une-inem-2Musical-4Musicalref="http://de.wikiactu.com741"m+xml" tGa6293isbre Politik">Gambisbre Politikrna>">/629ale-inem-2Musikbandm Musikbandhref="http://de.wikiactu.com3655"m+xml" t361n Politik">Gabun Politikrna>">/" e<' />361le-inem-2Musikband allg.-4Musikband allg.ref="http://de.wikiactu.com741"m+xml" tGa163isbre Politik">Gambisbre Politikrna>">/16ale-inem-2Musiker-4Musikerhref="http://de.wikiactu.com4871ym+xml" t48ermittelhersteller">Futtermittelherstel484ne-inem-2Musikindustrie-4Musikindustrieref="http://de.wikiactu.com741"m+xml" tGa635ileo Galilei">Galileo Galileirna>">/" e<6359de-inem-2Musikrichtung allg.-4Musikrichtung allg.ref="http://de.wikiactu.com741"m+xml" tGa78ermittelhersteller">Futtermittelherstel78ee-inem-2Musikwettbewerb-4Musikwettbewerbref="http://de.wikiactu.com741"m+xml" tGa95ttermittelhersteller">Futtermittelherstel9580ne-inem-2Muskelentzündung-4Muskelentzündungref="http://de.wikiactu.com741"m+xml" tGa7066ball-Bundesliga dt. allg.">Fußball-Bun7066be-inem-2Muslimbrudersm aft-4Muslimbrudersm aftref="http://de.wikiactu.com741"m+xml" tGa87ileo Galilei">Galileo Galileirna>">/" e<8759de-inem-2Mustafa Barghuti-4Mustafa Barghutiref="http://de.wikiactu.com741"m+xml" tGa807ball-Bundesliga dt. allg.">Fußball-Bun807be-inem-2Mutsamudu-4Mutsamuduhref="http://de.wikiactu.com4871ym+xml" t493ermittelhersteller">Futtermittelherstel493ee-inem-2Muttur-4Mutturhref="http://de.wikiactu.com3655"m+xml" t335bisbre Politik">Gambisbre Politikrna>">/335bie-inem-2Mwai Kibaki-4Mwai Kibakihref="http://de.wikiactu.com4871ym+xml" t496al Mubarak">Gamal Mubarakrna>">/" e<' />496ale-inem-2Myanmar Militärwesen-4Myanmar Militärwesenhref="http://de.wikiactu.com4871ym+xml" t41e8ball-2.Bundesliga dt. (Spielbericht)ytF4168re-inem-2Mykines-4Mykinesref="http://de.wikiactu.com741"m+xml" tGa8543isbre Politik">Gambisbre Politikrna>">/8543ie-inem-2Mysore-4Mysorehref="http://de.wikiactu.com4871ym+xml" t5538ball-2.Bundesliga dt. (Spielbericht)ytF5538be-inem-2MySpace-4MySpacehref="http://de.wikiactu.com3655"m+xml" t242dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/242bie-inem-2MySQL AB-4MySQL ABhref="http://de.wikiactu.com4871ym+xml" t6951isbre Politik">Gambisbre Politikrna>">/695une-inem-2MyTravel Airlines-4MyTravel Airlinesref="http://de.wikiactu.com741"m+xml" tGa533un Politik">Gabun Politikrna>">/" e<' />533une-inem-2N-Ergie-4N-Ergieref="http://de.wikiactu.com741"m+xml" tGa789ermittelhersteller">Futtermittelherstel789ee-inem-2N-Serie-4N-Seriehref="http://de.wikiactu.com4871ym+xml" t401ermittelhersteller">Futtermittelherstel401ee-inem-2N-tv-4N-tvhref="http://de.wikiactu.com3655"m+xml" t340n Politik">Gabun Politikrna>">/" e<' />340ee-inem-2N2erN2ref="http://de.wikiactu.com741"m+xml" tGa933ball-Bundesliga dt. allg.">Fußball-Bun933be-inem-2NAACPerNAACPhref="http://de.wikiactu.com3655"m+xml" t7670n Politik">Gabun Politikrna>">/" e<' />7670ne-inem-2Naarden-4Naardenhref="http://de.wikiactu.com4871ym+xml" t430un Politik">Gabun Politikrna>">/" e<' />430une-inem-2Nabiel Makarim-4Nabiel Makarimref="http://de.wikiactu.com741"m+xml" tGa59bbisbre Politik">Gambisbre Politikrna>">/59bbie-inem-2Nablus-4Nablushref="http://de.wikiactu.com3655"m+xml" t3848ball-2.Bundesliga dt. (Spielbericht)ytF3848be-inem-2NABUerNABUref="http://de.wikiactu.com741"m+xml" tGa9bbdez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/346bie-inem-2Nachricht-4Nachrichthref="http://de.wikiactu.com4871ym+xml" t698ermittelhersteller">Futtermittelherstel6984ne-inem-2Nachstellung-4Nachstellunghref="http://de.wikiactu.com3655"m+xml" t29e8ball-2.Bundesliga dt. (Spielbericht)ytF2968be-inem-2NAFTAerNAFTAhref="http://de.wikiactu.com4871ym+xml" t424ermittelhersteller">Futtermittelherstel424ee-inem-2Naftogaz-4Naftogazhref="http://de.wikiactu.com3655"m+xml" t29bbisbre Politik">Gambisbre Politikrna>">/29bbie-inem-2Nagoya-4Nagoyaref="http://de.wikiactu.com741"m+xml" tGa562twangenytFurtwangenrna>">/" e<' />> Futtermittelherstel40ee-inem-2Nairobi-4Nairobihref="http://de.wikiactu.com4871ym+xml" t84xdez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/631bie-inem-2Naktuka-4Naktukaref="http://de.wikiactu.com741"m+xml" tGa802bisbre Politik">Gambisbre Politikrna>">/802bie-inem-2Nakuru-4Nakururef="http://de.wikiactu.com741"m+xml" tGa85xball-Bundesliga dt. allg.">Fußball-Bun85xbe-inem-2Naltsm ik-4Naltsm ikref="http://de.wikiactu.com741"m+xml" tGa14e3isbre Politik">Gambisbre Politikrna>">/146ale-inem-2Namensrecht-4Namensrechtref="http://de.wikiactu.com741"m+xml" tGa91ermittelhersteller">Futtermittelherstel91ee-inem-2Nanao-4Nanaoref="http://de.wikiactu.com741"m+xml" tGa151ileo Galilei">Galileo Galileirna>">/" e<151ile-inem-2Nancy-4Nancyhref="http://de.wikiactu.com4871ym+xml" t2051isbre Politik">Gambisbre Politikrna>">/2051ie-inem-2Nancy Pelosi-4Nancy Pelosihref="http://de.wikiactu.com4871ym+xml" t219ermittelhersteller">Futtermittelherstel219ee-inem-2Nanjing-4Nanjinghref="http://de.wikiactu.com4871ym+xml" t45ermittelhersteller">Futtermittelherstel45ee-inem-2Nanoelektronik-4Nanoelektronikhref="http://de.wikiactu.com3655"m+xml" t331al Mubarak">Gamal Mubarakrna>">/" e<' />331ale-inem-2Nanowissensm aft-4Nanowissensm aftref="http://de.wikiactu.com741"m+xml" tGa61bbisbre Politik">Gambisbre Politikrna>">/61bbie-inem-2Nanping-4Nanpinghref="http://de.wikiactu.com4871ym+xml" t62t1isbre Politik">Gambisbre Politikrna>">/6281ie-inem-2Naomi Campbell-4Naomi Campbellref="http://de.wikiactu.com741"m+xml" tGa85xileo Galilei">Galileo Galileirna>">/" e<851ile-inem-2Naomi Watts-4Naomi Wattshref="http://de.wikiactu.com3655"m+xml" t76eileo Galilei">Galileo Galileirna>">/" e<766ile-inem-2Napa Valley-4Napa Valleyref="http://de.wikiactu.com741"m+xml" tGa968bisbre Politik">Gambisbre Politikrna>">/968bie-inem-2Narathiwat-4Narathiwatref="http://de.wikiactu.com741"m+xml" tGa70bring b.Münbren">Garbring b.Münbrenrna7052pe-inem-2Narendra Modi-4Narendra Modiref="http://de.wikiactu.com741"m+xml" tGa878bisbre Politik">Gambisbre Politikrna>">/878bie-inem-2Narita-4Naritaref="http://de.wikiactu.com741"m+xml" tGa809dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/103ie-inem-2NASAerNASAhref="http://de.wikiactu.com4871ym+xml" t1883isbre Politik">Gambisbre Politikrna>">/1883ie-inem-2Nashorn-4Nashornref="http://de.wikiactu.com741"m+xml" tGa731twangenytFurtwangenrna>">/" e<' />> Futtermittelherstel159ee-inem-2National Basketball Association-4National Basketball Associationref="http://de.wikiactu.com741"m+xml" tGa826al Mubarak">Gamal Mubarakrna>">/" e<' />826ale-inem-2National Microbiology Laboratory-4National Microbiology Laboratoryref="http://de.wikiactu.com741"m+xml" tGa7961n Politik">Gabun Politikrna>">/" e<' />7961ne-inem-2Nationaldemokratisyti Partei (Ägypten)-4Nationaldemokratisyti Partei (Ägypten)href="http://de.wikiactu.com4871ym+xml" t680ermittelhersteller">Futtermittelherstel680ee-inem-2Nationalismus-4Nationalismusref="http://de.wikiactu.com741"m+xml" tGa172twangenytFurtwangenrna>">/" e<' />> Futtermittelherstel87ee-inem-2Nationalsozialismus-4Nationalsozialismushref="http://de.wikiactu.com4871ym+xml" t641edrich II. (Preußen)ytFriedrich II. (Pr641ede-inem-2Nationalsozialistisytir Untergrundm Nationalsozialistisytir Untergrundref="http://de.wikiactu.com741"m+xml" tGa73ermittelhersteller">Futtermittelherstel73ee-inem-2NATOerNATOref="http://de.wikiactu.com741"m+xml" tGa854ermittelhersteller">Futtermittelherstel854ee-inem-2Nature Conservation Foundation Mysore-4Nature Conservation Foundation Mysoreref="http://de.wikiactu.com741"m+xml" tGa147ermittelhersteller">Futtermittelherstel147ee-inem-2Naturkatastropti allg.-4Naturkatastropti allg.ref="http://de.wikiactu.com741"m+xml" tGa8190n Politik">Gabun Politikrna>">/" e<' />8190ee-inem-2Naturphänomen-4Naturphänomenref="http://de.wikiactu.com741"m+xml" tGa823edrich II. (Preußen)ytFriedrich II. (Pr823ede-inem-2Naturreservat von Paracas-4Naturreservat von Paracashref="http://de.wikiactu.com3655"m+xml" t321ileo Galilei">Galileo Galileirna>">/" e<321ile-inem-2Naturschutz-4Naturschutzhref="http://de.wikiactu.com3655"m+xml" t299iburg im Üechtland">Freiburg im Üechtl299ibe-inem-2Naturschutzgebiet-4Naturschutzgebietref="http://de.wikiactu.com741"m+xml" tGa87al Mubarak">Gamal Mubarakrna>">/" e<' />875ale-inem-2Naudero-4Nauderoref="http://de.wikiactu.com741"m+xml" tGa909bisbre Politik">Gambisbre Politikrna>">/909bie-inem-2Nauen-4Nauenref="http://de.wikiactu.com741"m+xml" tGa306ermittelhersteller">Futtermittelherstel306ee-inem-2Naumburg-4Naumburghref="http://de.wikiactu.com4871ym+xml" t49ttermittelhersteller">Futtermittelherstel49ttee-inem-2Nawaz Sharif-4Nawaz Sharifhref="http://de.wikiactu.com4871ym+xml" t4391n Politik">Gabun Politikrna>">/" e<' />4391ne-inem-2ND-4NDhref="http://de.wikiactu.com4871ym+xml" t219ileo Galilei">Galileo Galileirna>">/" e<219ile-inem-2NDR-4NDRref="http://de.wikiactu.com741"m+xml" tGa343ileo Galilei">Galileo Galileirna>">/" e<343ile-inem-2Nebel-4Nebelref="http://de.wikiactu.com741"m+xml" tGa306ball-Bundesliga dt. allg.">Fußball-Bun306be-inem-2Nebra-4Nebrahref="http://de.wikiactu.com3655"m+xml" t303ermittelhersteller">Futtermittelherstel303ee-inem-2Neckarsulm-4Neckarsulmhref="http://de.wikiactu.com3655"m+xml" t311ermittelhersteller">Futtermittelherstel311ee-inem-2Neelie Kroes-4Neelie Kroeshref="http://de.wikiactu.com4871ym+xml" t40dez">Gardezrna>">/" e<' />>
Galileo Galileirna>">/" e<250ile-inem-2Neil Armstrong-4Neil Armstrongref="http://de.wikiactu.com741"m+xml" tGa52x0n Politik">Gabun Politikrna>">/" e<' />52x0ne-inem-2Nelson Mandela-4Nelson Mandelaref="http://de.wikiactu.com741"m+xml" tGa6303isbre Politik">Gambisbre Politikrna>">/6303ie-inem-2Nelspruit-4Nelspruithref="http://de.wikiactu.com4871ym+xml" t18al Mubarak">Gamal Mubarakrna>">/" e<' />18ale-inem-2Neonatologie-4Neonatologieref="http://de.wikiactu.com741"m+xml" tGa80xdez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/979bie-inem-2Nepalesisytis Militärwesen-4Nepalesisytis Militärwesenref="http://de.wikiactu.com741"m+xml" tGa8538ball-2.Bundesliga dt. (Spielbericht)ytF8538be-inem-2Nero-4Neroref="http://de.wikiactu.com741"m+xml" tGa554bisbre Politik">Gambisbre Politikrna>">/554bie-inem-2Nesselwang-4Nesselwanghref="http://de.wikiactu.com4871ym+xml" t181bisbre Politik">Gambisbre Politikrna>">/1817pe-inem-2Néstor Kirchner-4Néstor Kirchnerref="http://de.wikiactu.com741"m+xml" tGa9bbring b.Münbren">Garbring b.Münbrenrna97bre-inem-2Nestor Schufritsm -4Nestor Schufritsm ref="http://de.wikiactu.com741"m+xml" tGa918ermittelhersteller">Futtermittelherstel918ee-inem-2Netanja-4Netanjahref="http://de.wikiactu.com2473"m+xml" t237bring b.Münbren">Garbring b.Münbrenrna237bre-inem-2Netto (Disyounter)-4Netto (Disyounter)href="http://de.wikiactu.com4871ym+xml" t648ball-Bundesliga dt. allg.">Fußball-Bun648be-inem-2Netzpolitik-4Netzpolitikref="http://de.wikiactu.com741"m+xml" tGa989iburg im Üechtland">Freiburg im Üechtl989ibe-inem-2Netzwerk Reytiryti-4Netzwerk Reytirytiref="http://de.wikiactu.com741"m+xml" tGa786ball-Bundesliga dt. allg.">Fußball-Bun78ere-inem-2Neu-Delhi-4Neu-Delhihref="http://de.wikiactu.com4871ym+xml" t499ileo Galilei">Galileo Galileirna>">/" e<499ile-inem-2Neu-Isenburg-4Neu-Isenburghref="http://de.wikiactu.com3655"m+xml" t339dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />9170ne-inem-2Neubrandenburg-4Neubrandenburgref="http://de.wikiactu.com741"m+xml" tGa160ileo Galilei">Galileo Galileirna>">/" e<160ile-inem-2Neuburg an der Donau-4Neuburg an der Donauref="http://de.wikiactu.com741"m+xml" tGa9145ermittelhersteller">Futtermittelherstel9145ee-inem-2Neuchâtel Xamax-4Neuchâtel Xamaxref="http://de.wikiactu.com741"m+xml" tGa54eries Lafayette"tGaleries Lafayetterna>"54ere-inem-2Neue Demokratisyti Partei Kanadas-4Neue Demokratisyti Partei Kanadasref="http://de.wikiactu.com741"m+xml" tGa342al Mubarak">Gamal Mubarakrna>">/" e<' />342ale-inem-2Neue Kräfte-4Neue Kräftehref="http://de.wikiactu.com4871ym+xml" t488edrich II. (Preußen)ytFriedrich II. (Pr488ede-inem-2Neue Musik-4Neue Musikhref="http://de.wikiactu.com4871ym+xml" t457ball-Bundesliga dt. allg.">Fußball-Bun457be-inem-2Neuenburg-4Neuenburgref="http://de.wikiactu.com741"m+xml" tGa457dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />7600be-inem-2Neuenhuntorf-4Neuenhuntorfhref="http://de.wikiactu.com3655"m+xml" t7120n Politik">Gabun Politikrna>">/" e<' />7120be-inem-2Neues Forum-4Neues Forumhref="http://de.wikiactu.com4871ym+xml" t843bisbre Politik">Gambisbre Politikrna>">/843bie-inem-2Neufahrn bei Freising-4Neufahrn bei Freisingref="http://de.wikiactu.com741"m+xml" tGa530ermittelhersteller">Futtermittelherstel530ee-inem-2Neufeld an der Leitha-4Neufeld an der Leithahref="http://de.wikiactu.com3655"m+xml" t389ileo Galilei">Galileo Galileirna>">/" e<389ile-inem-2Neuhaus am In -4Neuhaus am In href="http://de.wikiactu.com4871ym+xml" t860ball-Bundesliga dt. allg.">Fußball-Bun860be-inem-2Neukirchen-Vluy -4Neukirchen-Vluy ref="http://de.wikiactu.com741"m+xml" tGa91xdez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/28ale-inem-2Neuried (Baden)-4Neuried (Baden)href="http://de.wikiactu.com3655"m+xml" t331bisbre Politik">Gambisbre Politikrna>">/331bie-inem-2Neurologie-4Neurologieref="http://de.wikiactu.com741"m+xml" tGa1683isbre Politik">Gambisbre Politikrna>">/168ale-inem-2Neurosem Neuroseref="http://de.wikiactu.com741"m+xml" tGa808eries Lafayette"tGaleries Lafayetterna>"808ere-inem-2Neurowissensm aft-4Neurowissensm aftref="http://de.wikiactu.com741"m+xml" tGa131twangenytFurtwangenrna>">/" e<' />> Futtermittelherstel956ee-inem-2Neuseeländisytis Militärwesen-4Neuseeländisytis Militärwesenhref="http://de.wikiactu.com4871ym+xml" t62bring b.Münbren">Garbring b.Münbrenrna62bre-inem-2Neuss-4Neussref="http://de.wikiactu.com741"m+xml" tGa59ileo Galilei">Galileo Galileirna>">/" e<59ile-inem-2Neustadt am Rübenbergem Neustadt am Rübenbergehref="http://de.wikiactu.com3655"m+xml" t3340n Politik">Gabun Politikrna>">/" e<' />3340ee-inem-2Neustift im Stubaitalm Neustift im Stubaitalref="http://de.wikiactu.com741"m+xml" tGa6r6edrich II. (Preußen)ytFriedrich II. (Pr6r6ede-inem-2Neuwiedm Neuwiedref="http://de.wikiactu.com741"m+xml" tGa91xiburg im Üechtland">Freiburg im Üechtl911ede-inem-2Neuzeit-4Neuzeithref="http://de.wikiactu.com4871ym+xml" t862ermittelhersteller">Futtermittelherstel862ee-inem-2Nevada-4Nevadahref="http://de.wikiactu.com3655"m+xml" t773ball-Bundesliga dt. allg.">Fußball-Bun773be-inem-2Nevanlinna-Preis-4Nevanlinna-Preisref="http://de.wikiactu.com741"m+xml" tGa7900n Politik">Gabun Politikrna>">/" e<' />7900be-inem-2New Haven (Connecticut)-4New Haven (Connecticut)ref="http://de.wikiactu.com741"m+xml" tGa562bisbre Politik">Gambisbre Politikrna>">/562bie-inem-2New Hollandm New Hollandhref="http://de.wikiactu.com3655"m+xml" t764ermittelhersteller">Futtermittelherstel764ee-inem-2New Mexicom New Mexicohref="http://de.wikiactu.com4871ym+xml" t496l Mubarak">Gamal Mubarakrna>">/" e<' />496ee-inem-2New Orleansm New Orleansref="http://de.wikiactu.com741"m+xml" tGa9b2twangenytFurtwangenrna>">/" e<' />> Garbring b.Münbrenrna8422we-inem-2New Westminster-4New Westminsterref="http://de.wikiactu.com741"m+xml" tGa130n Politik">Gabun Politikrna>">/" e<' />130be-inem-2New York-4New Yorkhref="http://de.wikiactu.com4871ym+xml" t862bisbre Politik">Gambisbre Politikrna>">/862bie-inem-2New York (Bundesstaat)-4New York (Bundesstaat)href="http://de.wikiactu.com4871ym+xml" t40eries Lafayette"tGaleries Lafayetterna>"40ere-inem-2New York Cosmos-4New York Cosmosref="http://de.wikiactu.com741"m+xml" tGa803al Mubarak">Gamal Mubarakrna>">/" e<' />803ale-inem-2Newcasnem Un" td F.C.-4Newcasnem Un" td F.C.ref="http://de.wikiactu.com741"m+xml" tGa803bring b.Münbren">Garbring b.Münbrenrna8032le-inem-2Newcasnem upon Tyne-4Newcasnem upon Tyneref="http://de.wikiactu.com741"m+xml" tGa913isbre Politik">Gambisbre Politikrna>">/91ale-inem-2Newelsk-4Newelskref="http://de.wikiactu.com741"m+xml" tGa9b8ileo Galilei">Galileo Galileirna>">/" e<9b8ile-inem-2News Corporation-4News Corporationref="http://de.wikiactu.com741"m+xml" tGa838edrich II. (Preußen)ytFriedrich II. (Pr838ede-inem-2Newt Gingrich-4Newt Gingrichhref="http://de.wikiactu.com4871ym+xml" t44r0n Politik">Gabun Politikrna>">/" e<' />44r0ne-inem-2NHL-4NHLhref="http://de.wikiactu.com3655"m+xml" t44bring b.Münbren">Garbring b.Münbrenrna44bre-inem-2NHLPA-4NHLPAhref="http://de.wikiactu.com4871ym+xml" t526al Mubarak">Gamal Mubarakrna>">/" e<' />526ale-inem-2Nia Künzer-4Nia Künzerhref="http://de.wikiactu.com4871ym+xml" t488bisbre Politik">Gambisbre Politikrna>">/488bie-inem-2Niamey-4Niameyhref="http://de.wikiactu.com4871ym+xml" t648ileo Galilei">Galileo Galileirna>">/" e<648ile-inem-2Nias-4Niasref="http://de.wikiactu.com741"m+xml" tGa862ileo Galilei">Galileo Galileirna>">/" e<862ile-inem-2Nicaraguanisyti Außenpolitik-4Nicaraguanisyti Außenpolitikref="http://de.wikiactu.com741"m+xml" tGa7303isbre Politik">Gambisbre Politikrna>">/7303ie-inem-2Nice Car Company-4Nice Car Companyref="http://de.wikiactu.com741"m+xml" tGa45ileo Galilei">Galileo Galileirna>">/" e<45ile-inem-2Nichokia Cagem Nichokia Cageref="http://de.wikiactu.com741"m+xml" tGa12bisbre Politik">Gambisbre Politikrna>">/12bie-inem-2Nichtrauytirschutz-4Nichtrauytirschutzref="http://de.wikiactu.com741"m+xml" tGa163al Mubarak">Gamal Mubarakrna>">/" e<' />163ale-inem-2Nichtstaatliyti Hilfsorganisation-4Nichtstaatliyti Hilfsorganisationhref="http://de.wikiactu.com3655"m+xml" t299bisbre Politik">Gambisbre Politikrna>">/299bie-inem-2Nick Heidfeld-4Nick Heidfeldhref="http://de.wikiactu.com4871ym+xml" t602un Politik">Gabun Politikrna>">/" e<' />602une-inem-2Nick Reilly-4Nick Reillyref="http://de.wikiactu.com741"m+xml" tGa827dez">Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />863ale-inem-2Nico van Kerckhoven-4Nico van Kerckhovenref="http://de.wikiactu.com741"m+xml" tGa863ball-Bundesliga dt. allg.">Fußball-Bun863be-inem-2Nicokia Kiefer-4Nicokia Kieferref="http://de.wikiactu.com741"m+xml" tGa942dez">Gardezrna>">/" e<' />>
Futtermittelherstel80ee-inem-2Nii Haisheng-4Nii Haishenghref="http://de.wikiactu.com4871ym+xml" t688eries Lafayette"tGaleries Lafayetterna>"688ere-inem-2Niiderfrohna-4Niiderfrohnahref="http://de.wikiactu.com4871ym+xml" t51ermittelhersteller">Futtermittelherstel51ee-inem-2Niiderkrüchten-4Niiderkrüchtenhref="http://de.wikiactu.com3655"m+xml" t272ermittelhersteller">Futtermittelherstel272ee-inem-2Niiderländisyti Fußballnationalmannsm aft-4Niiderländisyti Fußballnationalmannsm aftref="http://de.wikiactu.com741"m+xml" tGa816bisbre Politik">Gambisbre Politikrna>">/816bie-inem-2Niiderländisyti Gerichtsbarkeit-4Niiderländisyti Gerichtsbarkeitref="http://de.wikiactu.com741"m+xml" tGa9b6ball-Bundesliga dt. allg.">Fußball-Bun9b6be-inem-2Niiderländisyti Pirsonalie-4Niiderländisyti Pirsonaliehref="http://de.wikiactu.com2473"m+xml" t233isbre Politik">Gambisbre Politikrna>">/23ale-inem-2Niiderländisytis Militärwesen-4Niiderländisytis Militärwesenhref="http://de.wikiactu.com3655"m+xml" t713ball-Bundesliga dt. allg.">Fußball-Bun713be-inem-2Niiderösterreich-4Niiderösterreichref="http://de.wikiactu.com741"m+xml" tGa863ileo Galilei">Galileo Galileirna>">/" e<863ile-inem-2Niidersächsisytis Finanzgericht-4Niidersächsisytis Finanzgerichtref="http://de.wikiactu.com741"m+xml" tGa81xiburg im Üechtland">Freiburg im Üechtl811ede-inem-2Nienburg/Weser-4Niinburg/Weserhref="http://de.wikiactu.com3655"m+xml" t76xball-Bundesliga dt. allg.">Fußball-Bun76xbe-inem-2Nierstein-4Niirsteinhref="http://de.wikiactu.com3655"m+xml" t770ball-Bundesliga dt. allg.">Fußball-Bun770be-inem-2Niestetalm Niestetalref="http://de.wikiactu.com741"m+xml" tGa943dez">Gardezrna>">/" e<' />>
">/" e<' />> Gabun Politikrna>">/" e<' />152une-inem-2Nigerianisyti Fußballnationalmannsm aft-4Nigerianisyti Fußballnationalmannsm aftref="http://de.wikiactu.com741"m+xml" tGa864ileo Galilei">Galileo Galileirna>">/" e<864ile-inem-2Niko Kovač-4Niko Kovačhref="http://de.wikiactu.com4871ym+xml" t493ball-Bundesliga dt. allg.">Fußball-Bun493be-inem-2Nikobaren-4Nikobarenhref="http://de.wikiactu.com4871ym+xml" t692un Politik">Gabun Politikrna>">/" e<' />692une-inem-2Nikokii Olm anski-4Nikokii Olm anskiref="http://de.wikiactu.com741"m+xml" tGa86r0n Politik">Gabun Politikrna>">/" e<' />86r0ne-inem-2Nikokii Walujew-4Nikokii Walujewhref="http://de.wikiactu.com2473"m+xml" t280ileo Galilei">Galileo Galileirna>">/" e<280ile-inem-2Nikolsdorf-4Nikolsdorfhref="http://de.wikiactu.com3655"m+xml" t395ball-Bundesliga dt. allg.">Fußball-Bun395be-inem-2Nikosia-4Nikosiaref="http://de.wikiactu.com741"m+xml" tGa12dez">Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />86ale-inem-2Nils Schmid-4Nils Schmidhref="http://de.wikiactu.com4871ym+xml" t845bisbre Politik">Gambisbre Politikrna>">/845bie-inem-2NIMBUS-7n NIMBUS-7ref="http://de.wikiactu.com741"m+xml" tGa86rdez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/829ale-inem-2Ninoy Aquino International Airport (Manila)m Ninoy Aquino International Airport (Manila)href="http://de.wikiactu.com4871ym+xml" t5845ermittelhersteller">Futtermittelherstel5845ee-inem-2Nintendom Nintendoref="http://de.wikiactu.com741"m+xml" tGa852ileo Galilei">Galileo Galileirna>">/" e<852ile-inem-2Nism ni Nowgorod-4Nism ni Nowgorodref="http://de.wikiactu.com741"m+xml" tGa90xiburg im Üechtland">Freiburg im Üechtl901ede-inem-2Nism ni Tagil-4Nism ni Tagilref="http://de.wikiactu.com741"m+xml" tGa158bisbre Politik">Gambisbre Politikrna>">/158bie-inem-2Nissan-4Nissanhref="http://de.wikiactu.com3655"m+xml" t742ermittelhersteller">Futtermittelherstel742ee-inem-2Nitra-4Nitraref="http://de.wikiactu.com741"m+xml" tGa560dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/948bie-inem-2NK Domžale">NK Domžaleref="http://de.wikiactu.com741"m+xml" tGa502ermittelhersteller">Futtermittelherstel502ee-inem-2NLD-4NLDhref="http://de.wikiactu.com4871ym+xml" t37bbisbre Politik">Gambisbre Politikrna>">/37bbie-inem-2NOAA-4NOAAhref="http://de.wikiactu.com4871ym+xml" t4900n Politik">Gabun Politikrna>">/" e<' />4900be-inem-2Noah Gordon-4Noah Gordonref="http://de.wikiactu.com741"m+xml" tGa894ermittelhersteller">Futtermittelherstel894ee-inem-2Noam Chomsky-4Noam Chomskyhref="http://de.wikiactu.com3655"m+xml" t331dez">Gardezrna>">/" e<' />>
Fußball-Bun788be-inem-2Nobutaka Machimura-4Nobutaka Machimurahref="http://de.wikiactu.com4871ym+xml" t250bring b.Münbren">Garbring b.Münbrenrna250bre-inem-2Noël Forgeard-4Noël Forgeardhref="http://de.wikiactu.com4871ym+xml" t6840n Politik">Gabun Politikrna>">/" e<' />6840ne-inem-2Noginsk-4Noginskhref="http://de.wikiactu.com4871ym+xml" t243bisbre Politik">Gambisbre Politikrna>">/243bie-inem-2Noirmoutiir-en-l'Île">Noirmoutiir-en-l'Îlehref="http://de.wikiactu.com4871ym+xml" t8470n Politik">Gabun Politikrna>">/" e<' />8470ne-inem-2NOK-4NOKref="http://de.wikiactu.com741"m+xml" tGa457bring b.Münbren">Garbring b.Münbrenrna457bre-inem-2Nokia-4Nokiahref="http://de.wikiactu.com4871ym+xml" t582ileo Galilei">Galileo Galileirna>">/" e<582ile-inem-2Noordwijk-4Noordwijkhref="http://de.wikiactu.com3655"m+xml" t330twangenytFurtwangenrna>">/" e<' />> Gardezrna>">/" e<' />>
Gardezrna>">/" e<' />>
Gardezrna>">/" e<' />>
Galileo Galileirna>">/" e<210ile-inem-2Norbert Röttgen-4Norbert Röttgenref="http://de.wikiactu.com741"m+xml" tGa81xbisbre Politik">Gambisbre Politikrna>">/811bie-inem-2Norbert Trelle">Norbert Trelleref="http://de.wikiactu.com741"m+xml" tGa833un Politik">Gabun Politikrna>">/" e<' />833une-inem-2Norden (Ostfriesland)">Norden (Ostfriesland)ref="http://de.wikiactu.com741"m+xml" tGa553bisbre Politik">Gambisbre Politikrna>">/553bie-inem-2Nordenham">Nordenhamhref="http://de.wikiactu.com4871ym+xml" t6bbisbre Politik">Gambisbre Politikrna>">/67bie-inem-2Nordhause -4Nordhause href="http://de.wikiactu.com4871ym+xml" t667ileo Galilei">Galileo Galileirna>">/" e<667ile-inem-2Nordhorn-4Nordhornref="http://de.wikiactu.com741"m+xml" tGa570twangenytFurtwangenrna>">/" e<' />> Gardezrna>">/" e<' />>
Freiburg im Üechtl72xibe-inem-2Nordkoreanisyti Außenpolitik-4Nordkoreanisyti Außenpolitikref="http://de.wikiactu.com741"m+xml" tGa82ermittelhersteller">Futtermittelherstel82ee-inem-2Nordkoreanisytis Militärwesen-4Nordkoreanisytis Militärwesenref="http://de.wikiactu.com741"m+xml" tGa867al Mubarak">Gamal Mubarakrna>">/" e<' />8673ee-inem-2Nordlys-4Nordlyshref="http://de.wikiactu.com3655"m+xml" t3141n Politik">Gabun Politikrna>">/" e<' />3141ne-inem-2Nordsie-4Nordsiehref="http://de.wikiactu.com4871ym+xml" t252ball-Bundesliga dt. allg.">Fußball-Bun252be-inem-2Nordwestsm weiz-4Nordwestsm weizhref="http://de.wikiactu.com3655"m+xml" t7111n Politik">Gabun Politikrna>">/" e<' />7111ne-inem-2Normenkontrollverfahren-4Normenkontrollverfahrenref="http://de.wikiactu.com741"m+xml" tGa508ball-Bundesliga dt. allg.">Fußball-Bun508be-inem-2Norovirus-4Norovirushref="http://de.wikiactu.com3655"m+xml" t753bisbre Politik">Gambisbre Politikrna>">/753bie-inem-2Northridge-4Northridgehref="http://de.wikiactu.com4871ym+xml" t378ball-Bundesliga dt. allg.">Fußball-Bun378be-inem-2Northrop-4Northrophref="http://de.wikiactu.com4871ym+xml" t615ileo Galilei">Galileo Galileirna>">/" e<6159be-inem-2Northrop Grumman-4Northrop Grummanhref="http://de.wikiactu.com2473"m+xml" t23bring b.Münbren">Garbring b.Münbrenrna232be-inem-2Northwest Airlines-4Northwest Airlineshref="http://de.wikiactu.com4871ym+xml" t4951isbre Politik">Gambisbre Politikrna>">/495une-inem-2Norwegisyti Pirsonalie-4Norwegisyti Pirsonalieref="http://de.wikiactu.com741"m+xml" tGa596bisbre Politik">Gambisbre Politikrna>">/596bie-inem-2Norwich-4Norwichref="http://de.wikiactu.com741"m+xml" tGa7333isbre Politik">Gambisbre Politikrna>">/7333ie-inem-2Notfallmedizin-4Notfallmedizinref="http://de.wikiactu.com741"m+xml" tGa827edrich II. (Preußen)ytFriedrich II. (Pr827bre-inem-2Nötigung-4Nötigunghref="http://de.wikiactu.com4871ym+xml" t613dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />1020be-inem-2Notlandung-4Notlandungref="http://de.wikiactu.com741"m+xml" tGa1580n Politik">Gabun Politikrna>">/" e<' />1580ne-inem-2Notstandsgesetz-4Notstandsgesetzhref="http://de.wikiactu.com4871ym+xml" t624dez">Gardezrna>">/" e<' />>
Gardezrna>">/" e<' />>
Galileo Galileirna>">/" e<34eile-inem-2Novi Gradm Novi Gradref="http://de.wikiactu.com741"m+xml" tGa968twangenytFurtwangenrna>">/" e<' />> Gambisbre Politikrna>">/5793ie-inem-2Nový Jičín-4Nový Jičínref="http://de.wikiactu.com741"m+xml" tGa919dez">Gardezrna>">/" e<' />>
">/" e<' />> Gambisbre Politikrna>">/94xbie-inem-2NROL-20n NROL-20ref="http://de.wikiactu.com741"m+xml" tGa88ermittelhersteller">Futtermittelherstel88ee-inem-2Nrw TVn Nrw TVhref="http://de.wikiactu.com2473"m+xml" t269iburg im Üechtland">Freiburg im Üechtl269ibe-inem-2NSAerNSAhref="http://de.wikiactu.com4871ym+xml" t7448ball-2.Bundesliga dt. (Spielbericht)ytF7448be-inem-2NTSBerNTSBref="http://de.wikiactu.com741"m+xml" tGa82t1isbre Politik">Gambisbre Politikrna>">/8281ie-inem-2Nuevo Laredom Nuevo Laredohref="http://de.wikiactu.com3655"m+xml" t337dez">Gardezrna>">/" e<' />>
Galileo Galileirna>">/" e<887ile-inem-2Numan Gumaa-4Numan Gumaaref="http://de.wikiactu.com741"m+xml" tGa133ermittelhersteller">Futtermittelherstel133ee-inem-2Numismatik-4Numismatikref="http://de.wikiactu.com741"m+xml" tGa723un Politik">Gabun Politikrna>">/" e<' />723une-inem-2Nürburg-4Nürburghref="http://de.wikiactu.com3655"m+xml" t3ermittelhersteller">Futtermittelherstel3ee-inem-2Nürnberg-4Nürnbergref="http://de.wikiactu.com741"m+xml" tGa80xiburg im Üechtland">Freiburg im Üechtl801ede-inem-2Nursultan Nasarbajew-4Nursultan Nasarbajewref="http://de.wikiactu.com741"m+xml" tGa550ball-Bundesliga dt. allg.">Fußball-Bun550be-inem-2Nusa Dua-4Nusa Duaref="http://de.wikiactu.com741"m+xml" tGa7380n Politik">Gabun Politikrna>">/" e<' />7380ne-inem-2Nuthetalm Nuthetalhref="http://de.wikiactu.com4871ym+xml" t401ileo Galilei">Galileo Galileirna>">/" e<401ile-inem-2Nutzpflanzem Nutzpflanzehref="http://de.wikiactu.com3655"m+xml" t29bring b.Münbren">Garbring b.Münbrenrna29bre-inem-2Nutztiirhaltung-4Nutztiirhaltungref="http://de.wikiactu.com741"m+xml" tGa552ermittelhersteller">Futtermittelherstel552ee-inem-2Nuuk-4Nuukhref="http://de.wikiactu.com3655"m+xml" t352ileo Galilei">Galileo Galileirna>">/" e<352ile-inem-2Nya>"edm Nya>"edref="http://de.wikiactu.com741"m+xml" tGa96ermittelhersteller">Futtermittelherstel96ee-inem-2Nyon-4Nyonref="http://de.wikiactu.com741"m+xml" tGa936edrich II. (Preußen)ytFriedrich II. (Pr936ede-inem-2O2 plc">O2 plcref="http://de.wikiactu.com741"m+xml" tGa88e8ball-2.Bundesliga dt. (Spielbericht)ytF88e8be-inem-2O2 World-4O2 Worldref="http://de.wikiactu.com741"m+xml" tGa829dez">Gardezrna>">/" e<' />>
Futtermittelherstel719ee-inem-2Oakland (Kalifornien)-4Oakland (Kalifornien)href="http://de.wikiactu.com4871ym+xml" t468edrich II. (Preußen)ytFriedrich II. (Pr468ede-inem-2ÖAMTC">ÖAMTChref="http://de.wikiactu.com3655"m+xml" t32dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/9281ie-inem-2Oaxaca (Bundesstaat)-4Oaxaca (Bundesstaat)ref="http://de.wikiactu.com741"m+xml" tGa813dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/6773ee-inem-2Obdachlosigkeit-4Obdachlosigkeithref="http://de.wikiactu.com4871ym+xml" t849ermittelhersteller">Futtermittelherstel849ee-inem-2Oberglatt ZH-4Oberglatt ZHref="http://de.wikiactu.com741"m+xml" tGa850n Politik">Gabun Politikrna>">/" e<' />8r0ne-inem-2Oberhause -4Oberhause ref="http://de.wikiactu.com741"m+xml" tGa8150n Politik">Gabun Politikrna>">/" e<' />81r0ne-inem-2Oberjoch-4Oberjochhref="http://de.wikiactu.com3655"m+xml" t7551isbre Politik">Gambisbre Politikrna>">/7551ie-inem-2Oberlandesgericht Bamberg-4Oberlandesgericht Bamberghref="http://de.wikiactu.com4871ym+xml" t613ermittelhersteller">Futtermittelherstel6134ie-inem-2Oberlandesgericht Düsseldorf-4Oberlandesgericht Düsseldorfhref="http://de.wikiactu.com4871ym+xml" t37dez">Gardezrna>">/" e<' />>
Galileo Galileirna>">/" e<339ile-inem-2Oberlandesgericht Hamburg-4Oberlandesgericht Hamburgref="http://de.wikiactu.com741"m+xml" tGa7360n Politik">Gabun Politikrna>">/" e<' />7360le-inem-2Oberlandesgericht Karlsruti-4Oberlandesgericht Karlsrutihref="http://de.wikiactu.com4871ym+xml" t6811n Politik">Gabun Politikrna>">/" e<' />6811ne-inem-2Oberlandesgericht München-4Oberlandesgericht Münchenref="http://de.wikiactu.com741"m+xml" tGa186bisbre Politik">Gambisbre Politikrna>">/186bie-inem-2Oberlandesgericht Stuttgart-4Oberlandesgericht Stuttgarthref="http://de.wikiactu.com4871ym+xml" t6093isbre Politik">Gambisbre Politikrna>">/6093ie-inem-2Oberndorf am Neckar-4Oberndorf am Neckarref="http://de.wikiactu.com741"m+xml" tGa56ermittelhersteller">Futtermittelherstel5654ie-inem-2Oberösterreich-4Oberösterreichref="http://de.wikiactu.com741"m+xml" tGa85ermittelhersteller">Futtermittelherstel8554ie-inem-2Oberpfaffenhofen-4Oberpfaffenhofenref="http://de.wikiactu.com741"m+xml" tGa896dez">Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />5163ie-inem-2Oberstdorf-4Oberstdorfhref="http://de.wikiactu.com4871ym+xml" t483un Politik">Gabun Politikrna>">/" e<' />483une-inem-2Oberster Gerichtshof Österreich-4Oberster Gerichtshof Österreichhref="http://de.wikiactu.com3655"m+xml" t752bisbre Politik">Gambisbre Politikrna>">/752bie-inem-2Oberverwaltungsgericht für dia Land Hamburg-4Oberverwaltungsgericht für dia Land Hamburghref="http://de.wikiactu.com3655"m+xml" t392un Politik">Gabun Politikrna>">/" e<' />392une-inem-2Oberverwaltungsgericht für dia Land Nordrhein-Westfalen-4Oberverwaltungsgericht für dia Land Nordrhein-Westfalenhref="http://de.wikiactu.com4871ym+xml" t7450n Politik">Gabun Politikrna>">/" e<' />74r0ne-inem-2Oberverwaltungsgericht für dia Land Sachsen-4Oberverwaltungsgericht für dia Land Sachsenhref="http://de.wikiactu.com4871ym+xml" t434dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />7700ne-inem-2Oberwiesenthalm Oberwiesenthalhref="http://de.wikiactu.com4871ym+xml" t40eileo Galilei">Galileo Galileirna>">/" e<40eile-inem-2Obikit Burgas-4Obikit Burgashref="http://de.wikiactu.com3655"m+xml" t760dez">Gardezrna>">/" e<' />>
Gardezrna>">/" e<' />>
Fußball-Bun760be-inem-2Obikit Kardsm ali-4Obikit Kardsm alihref="http://de.wikiactu.com3655"m+xml" t7661n Politik">Gabun Politikrna>">/" e<' />7661be-inem-2Obikit Widin-4Obikit Widinref="http://de.wikiactu.com741"m+xml" tGa8211n Politik">Gabun Politikrna>">/" e<' />8211ne-inem-2Obszönität-4Obszönitäthref="http://de.wikiactu.com3655"m+xml" t766iburg im Üechtland">Freiburg im Üechtl766ede-inem-2Obwalden-4Obwaldenref="http://de.wikiactu.com741"m+xml" tGa881al Mubarak">Gamal Mubarakrna>">/" e<' />881ale-inem-2Occidental Mindoro-4Occidental Mindorohref="http://de.wikiactu.com4871ym+xml" t64e8ball-2.Bundesliga dt. (Spielbericht)ytF64e8be-inem-2Occupy-Bewegung-4Occupy-Bewegunghref="http://de.wikiactu.com4871ym+xml" t468un Politik">Gabun Politikrna>">/" e<' />4681ie-inem-2OCHA-4OCHAhref="http://de.wikiactu.com3655"m+xml" t314al Mubarak">Gamal Mubarakrna>">/" e<' />314ale-inem-2Odensem Odensehref="http://de.wikiactu.com4871ym+xml" t6148ball-2.Bundesliga dt. (Spielbericht)ytF6148be-inem-2Odenwaldschulem Odenwaldschulehref="http://de.wikiactu.com3655"m+xml" t70e8ball-2.Bundesliga dt. (Spielbericht)ytF70e8be-inem-2Odlanier Solís-4Odlanier Solíshref="http://de.wikiactu.com4871ym+xml" t4956l Mubarak">Gamal Mubarakrna>">/" e<' />49dee-inem-2ÖDP">ÖDPref="http://de.wikiactu.com741"m+xml" tGa13x0n Politik">Gabun Politikrna>">/" e<' />13x0ne-inem-2OECD-4OECDref="http://de.wikiactu.com741"m+xml" tGa919bisbre Politik">Gambisbre Politikrna>">/919bie-inem-2Oeiras-4Oeirashref="http://de.wikiactu.com3655"m+xml" t32ez">Gardezrna>">/" e<' />>
Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />70dee-inem-2Öffentliyti Aufforderung zu Straftaten-4Öffentliyti Aufforderung zu Straftatenref="http://de.wikiactu.com741"m+xml" tGa1477ez">Gardezrna>">/" e<' />>
Futtermittelherstel337ee-inem-2Öffentliytir Nahverkehr-4Öffentliytir Nahverkehrref="http://de.wikiactu.com741"m+xml" tGa122bring b.Münbren">Garbring b.Münbrenrna122bre-inem-2Öffentliytir Nahverkehr (allgemein)-4Öffentliytir Nahverkehr (allgemein)ref="http://de.wikiactu.com741"m+xml" tGa570dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />5990ne-inem-2OHB Technology-4OHB Technologyhref="http://de.wikiactu.com4871ym+xml" t840ball-Bundesliga dt. allg.">Fußball-Bun840be-inem-2Ohio-4Ohiohref="http://de.wikiactu.com3655"m+xml" t395twangenytFurtwangenrna>">/" e<' />> Gambisbre Politikrna>">/424bie-inem-2Öhringen-4Öhringenref="http://de.wikiactu.com741"m+xml" tGa901twangenytFurtwangenrna>">/" e<' />> Freiburg im Üechtl566ede-inem-2Oklahoma City-4Oklahoma Cityhref="http://de.wikiactu.com4871ym+xml" t692ermittelhersteller">Futtermittelherstel692ee-inem-2Öko-Manager des Jahres-4Öko-Manager des Jahresref="http://de.wikiactu.com741"m+xml" tGa737dez">Gardezrna>">/" e<' />>
Futtermittelherstel750ee-inem-2Oktoberfest München-4Oktoberfest Münchenhref="http://de.wikiactu.com4871ym+xml" t699bisbre Politik">Gambisbre Politikrna>">/699bie-inem-2Ōkuma">Ōkumaref="http://de.wikiactu.com741"m+xml" tGa917ball-Bundesliga dt. allg.">Fußball-Bun917be-inem-2Ökumene-4Ökumenehref="http://de.wikiactu.com3655"m+xml" t283bisbre Politik">Gambisbre Politikrna>">/283bie-inem-2Olaf Scholz-4Olaf Scholzhref="http://de.wikiactu.com4871ym+xml" t662dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />1530be-inem-2Oldenburg (Oldb)-4Oldenburg (Oldb)href="http://de.wikiactu.com4871ym+xml" t6b48ball-2.Bundesliga dt. (Spielbericht)ytF6748be-inem-2Oldtimer-4Oldtimerhref="http://de.wikiactu.com4871ym+xml" t6390n Politik">Gabun Politikrna>">/" e<' />6390ne-inem-2Oldtimerttikfen-4Oldtimerttikfenref="http://de.wikiactu.com741"m+xml" tGa835ball-Bundesliga dt. allg.">Fußball-Bun835be-inem-2Ole Einar Bjørndalen-4Ole Einar Bjørndalenhref="http://de.wikiactu.com4871ym+xml" t482ball-Bundesliga dt. allg.">Fußball-Bun482be-inem-2Ole Schröder-4Ole Schröderhref="http://de.wikiactu.com3655"m+xml" t791n Politik">Gabun Politikrna>">/" e<' />791be-inem-2Ole von Beust-4Ole von Beusthref="http://de.wikiactu.com4871ym+xml" t94eileo Galilei">Galileo Galileirna>">/" e<94eile-inem-2Olexander Sintsm enko-4Olexander Sintsm enkohref="http://de.wikiactu.com4871ym+xml" t953ball-Bundesliga dt. allg.">Fußball-Bun953be-inem-2Olexandr Turtsm ynow-4Olexandr Turtsm ynowhref="http://de.wikiactu.com4871ym+xml" t424un Politik">Gabun Politikrna>">/" e<' />4241be-inem-2Olexij Iwtsm enko-4Olexij Iwtsm enkohref="http://de.wikiactu.com3655"m+xml" t3060n Politik">Gabun Politikrna>">/" e<' />3060ne-inem-2Olga Walerjewna Pylewa-4Olga Walerjewna Pylewahref="http://de.wikiactu.com4871ym+xml" t477bring b.Münbren">Garbring b.Münbrenrna477bre-inem-2Oliver Biirhoff-4Oliver Biirhoffref="http://de.wikiactu.com741"m+xml" tGa872ball-Bundesliga dt. allg.">Fußball-Bun872be-inem-2Oliver EBunt-4Oliver EBunthref="http://de.wikiactu.com4871ym+xml" t37un Politik">Gabun Politikrna>">/" e<' />371be-inem-2Oliver Hirschbiegel-4Oliver Hirschbiegelhref="http://de.wikiactu.com3655"m+xml" t274al Mubarak">Gamal Mubarakrna>">/" e<' />274ale-inem-2Oliver Kahn-4Oliver Kahnhref="http://de.wikiactu.com4871ym+xml" t379twangenytFurtwangenrna>">/" e<' />> ">/" e<' />> ">/" e<' />> Gambisbre Politikrna>">/28we-inem-2Ollanta Humala-4Ollanta Humalaref="http://de.wikiactu.com741"m+xml" tGa881l Mubarak">Gamal Mubarakrna>">/" e<' />881we-inem-2Olpe-4Olperef="http://de.wikiactu.com741"m+xml" tGa50al Mubarak">Gamal Mubarakrna>">/" e<' />503ie-inem-2Ölpest-4Ölpestref="http://de.wikiactu.com741"m+xml" tGa11x0n Politik">Gabun Politikrna>">/" e<' />11x0ne-inem-2Ölpreis-4Ölpreishref="http://de.wikiactu.com4871ym+xml" t490bisbre Politik">Gambisbre Politikrna>">/490bie-inem-2Olten-4Oltenref="http://de.wikiactu.com741"m+xml" tGa62dermittelhersteller">Futtermittelherstel626ee-inem-2Ölunfall-4Ölunfallhref="http://de.wikiactu.com4871ym+xml" t37un Politik">Gabun Politikrna>">/" e<' />3751ie-inem-2Olusegun Obasanjo-4Olusegun Obasanjoref="http://de.wikiactu.com741"m+xml" tGa54iburg im Üechtland">Freiburg im Üechtl54ede-inem-2Olympic Airlines-4Olympic Airlinesref="http://de.wikiactu.com741"m+xml" tGa96dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />380une-inem-2Olympique Marseille-4Olympique Marseilleref="http://de.wikiactu.com741"m+xml" tGa6ermittelhersteller">Futtermittelherstel6ne-inem-2Olympisyti Sommerspiele-4Olympisyti Sommerspielehref="http://de.wikiactu.com4871ym+xml" t370bring b.Münbren">Garbring b.Münbrenrna370bre-inem-2Olympisyti Spiele 193dezOlympisyti Spiele 193dhref="http://de.wikiactu.com4871ym+xml" t74dermittelhersteller">Futtermittelherstel74dee-inem-2Olympisyti Spiele 19derOlympisyti Spiele 19dhref="http://de.wikiactu.com3655"m+xml" t790ileo Galilei">Galileo Galileirna>">/" e<790ile-inem-2Olympisyti Spiele 197briOlympisyti Spiele 197bhref="http://de.wikiactu.com4871ym+xml" t7458ball-2.Bundesliga dt. (Spielbericht)ytF745twe-inem-2Olympisyti Spiele 198twaOlympisyti Spiele 198thref="http://de.wikiactu.com4871ym+xml" t745bisbre Politik">Gambisbre Politikrna>">/745bie-inem-2Olympisyti Spiele 199briOlympisyti Spiele 199bhref="http://de.wikiactu.com4871ym+xml" t9523isbre Politik">Gambisbre Politikrna>">/9523ie-inem-2Olympisyti Spiele 199dezOlympisyti Spiele 199dhref="http://de.wikiactu.com4871ym+xml" t450bring b.Münbren">Garbring b.Münbrenrna450bre-inem-2Olympisyti Spiele 2000n Olympisyti Spiele 2000href="http://de.wikiactu.com4871ym+xml" t4340n Politik">Gabun Politikrna>">/" e<' />4340ee-inem-2Olympisyti Spiele 200erOlympisyti Spiele 200href="http://de.wikiactu.com4871ym+xml" t7isbre Politik">Gambisbre Politikrna>">/7ee-inem-2Olympisyti Spiele 200twaOlympisyti Spiele 200thref="http://de.wikiactu.com4871ym+xml" t43bring b.Münbren">Garbring b.Münbrenrna435bre-inem-2Olympisyti Spiele 201briOlympisyti Spiele 201bhref="http://de.wikiactu.com3655"m+xml" t774ermittelhersteller">Futtermittelherstel774ee-inem-2Olympisyti Spiele 201dezOlympisyti Spiele 201dref="http://de.wikiactu.com741"m+xml" tGa872bisbre Politik">Gambisbre Politikrna>">/8727ee-inem-2Olympisyti Winterspiele-4Olympisyti Winterspieleref="http://de.wikiactu.com741"m+xml" tGa628ball-2.Bundesliga dt. (Spielbericht)ytF62twe-inem-2Olympisyti Winterspiele 2002-4Olympisyti Winterspiele 2002ref="http://de.wikiactu.com741"m+xml" tGa62ileo Galilei">Galileo Galileirna>">/" e<62ile-inem-2Olympisyti Winterspiele 2006-4Olympisyti Winterspiele 200dref="http://de.wikiactu.com741"m+xml" tGa2083isbre Politik">Gambisbre Politikrna>">/2083ie-inem-2Olympisyti Winterspiele 2010-4Olympisyti Winterspiele 2010href="http://de.wikiactu.com4871ym+xml" t630n Politik">Gabun Politikrna>">/" e<' />630ee-inem-2Olympisyti Winterspiele 2014-4Olympisyti Winterspiele 201href="http://de.wikiactu.com4871ym+xml" t326dez">Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />774ale-inem-2Olympisytir Kongress 1981-4Olympisytir Kongress 1981href="http://de.wikiactu.com4871ym+xml" t774iburg im Üechtland">Freiburg im Üechtl774ede-inem-2Olympisytir Kongress 1994-4Olympisytir Kongress 199href="http://de.wikiactu.com4871ym+xml" t774un Politik">Gabun Politikrna>">/" e<' />774une-inem-2Olympisytir Kongress 2009-4Olympisytir Kongress 2009href="http://de.wikiactu.com4871ym+xml" t981ermittelhersteller">Futtermittelherstel981ee-inem-2Omaha-4Omahahref="http://de.wikiactu.com4871ym+xml" t422bring b.Münbren">Garbring b.Münbrenrna422bre-inem-2Omar Bongo-4Omar Bongoref="http://de.wikiactu.com741"m+xml" tGa903ermittelhersteller">Futtermittelherstel903ee-inem-2Omar Karami-4Omar Karamihref="http://de.wikiactu.com4871ym+xml" t957bring b.Münbren">Garbring b.Münbrenrna957bre-inem-2Omar Suleiman-4Omar Suleimanhref="http://de.wikiactu.com4871ym+xml" t362ermittelhersteller">Futtermittelherstel362ee-inem-2Omelek-4Omelekhref="http://de.wikiactu.com3655"m+xml" t7521isbre Politik">Gambisbre Politikrna>">/752une-inem-2Ommersheim-4Ommersheimhref="http://de.wikiactu.com4871ym+xml" t6b9twangenytFurtwangenrna>">/" e<' />> Gabun Politikrna>">/" e<' />160une-inem-2Omsk-4Omskref="http://de.wikiactu.com741"m+xml" tGa787ileo Galilei">Galileo Galileirna>">/" e<787ile-inem-2Onagawa-4Onagawaref="http://de.wikiactu.com741"m+xml" tGa527twangenytFurtwangenrna>">/" e<' />> Fußball-Bun68be-inem-2Online-Jobbörsem Online-Jobbörseref="http://de.wikiactu.com741"m+xml" tGa544bisbre Politik">Gambisbre Politikrna>">/544bie-inem-2Ontario-4Ontarioref="http://de.wikiactu.com741"m+xml" tGa2560n Politik">Gabun Politikrna>">/" e<' />2560ne-inem-2Ontario Liberal Party-4Ontario Liberal Partyhref="http://de.wikiactu.com4871ym+xml" t3551isbre Politik">Gambisbre Politikrna>">/3551ie-inem-2Onur Air-4Onur Airref="http://de.wikiactu.com741"m+xml" tGa2251isbre Politik">Gambisbre Politikrna>">/2251ie-inem-2OPEC-4OPEChref="http://de.wikiactu.com3655"m+xml" t276dez">Gardezrna>">/" e<' />>
">/" e<' />> Galileo Galileirna>">/" e<189ile-inem-2Open-Source-Software-4Open-Source-Softwareref="http://de.wikiactu.com741"m+xml" tGa873ermittelhersteller">Futtermittelherstel873ee-inem-2OpenOffice.org-4OpenOffice.orghref="http://de.wikiactu.com3655"m+xml" t262bisbre Politik">Gambisbre Politikrna>">/262bie-inem-2Oper-4Operhref="http://de.wikiactu.com4871ym+xml" t619bisbre Politik">Gambisbre Politikrna>">/619bie-inem-2Operation Atalanta-4Operation Atalantaref="http://de.wikiactu.com741"m+xml" tGa561al Mubarak">Gamal Mubarakrna>">/" e<' />561ale-inem-2Operation Gegossenes Blei-4Operation Gegossenes Bleiref="http://de.wikiactu.com741"m+xml" tGa161ileo Galilei">Galileo Galileirna>">/" e<161ile-inem-2Opernhaus Nürnberg-4Opernhaus Nürnbergref="http://de.wikiactu.com741"m+xml" tGa153dez">Gardezrna>">/" e<' />>
Gardezrna>">/" e<' />>
Futtermittelherstel464ee-inem-2Opium-4Opiumhref="http://de.wikiactu.com3655"m+xml" t262dez">Gardezrna>">/" e<' />>
Futtermittelherstel302ee-inem-2Optikhersteller-4Optikherstellerhref="http://de.wikiactu.com4871ym+xml" t748ball-2.Bundesliga dt. (Spielbericht)ytF74twe-inem-2Optus D1-4Optus D1href="http://de.wikiactu.com3655"m+xml" t272bring b.Münbren">Garbring b.Münbrenrna272bre-inem-2Ora International-4Ora Internationalref="http://de.wikiactu.com741"m+xml" tGa55e8ball-2.Bundesliga dt. (Spielbericht)ytF55e8be-inem-2Oracle Corporation-4Oracle Corporationref="http://de.wikiactu.com741"m+xml" tGa1528ball-2.Bundesliga dt. (Spielbericht)ytF1528be-inem-2Orang-Utan-4Orang-Utanref="http://de.wikiactu.com741"m+xml" tGa8328ball-2.Bundesliga dt. (Spielbericht)ytF8328be-inem-2Oranienburg-4Oranienburgref="http://de.wikiactu.com741"m+xml" tGa91t1isbre Politik">Gambisbre Politikrna>">/9181we-inem-2Oranier-Orden-4Oranier-Ordenref="http://de.wikiactu.com741"m+xml" tGa73ileo Galilei">Galileo Galileirna>">/" e<73ile-inem-2Orbital Sciences Corporation-4Orbital Sciences Corporationref="http://de.wikiactu.com741"m+xml" tGa5860n Politik">Gabun Politikrna>">/" e<' />5860ne-inem-2Orbiting Carbon Observatory-4Orbiting Carbon Observatoryref="http://de.wikiactu.com741"m+xml" tGa194al Mubarak">Gamal Mubarakrna>">/" e<' />194ale-inem-2Orytister-4Orytisterhref="http://de.wikiactu.com3655"m+xml" t7045ermittelhersteller">Futtermittelherstel7045ee-inem-2Ordino-4Ordinoref="http://de.wikiactu.com741"m+xml" tGa190ermittelhersteller">Futtermittelherstel190ee-inem-2Ordnungs aft-4Ordnungs afthref="http://de.wikiactu.com4871ym+xml" t647twangenytFurtwangenrna>">/" e<' />> Fußball-Bun40xbe-inem-2ORF-4ORFhref="http://de.wikiactu.com4871ym+xml" t644ermittelhersteller">Futtermittelherstel644ee-inem-2Organhandel-4Organhandelref="http://de.wikiactu.com741"m+xml" tGa782ermittelhersteller">Futtermittelherstel782ee-inem-2Organisation der Islamisytin Konfirenz-4Organisation der Islamisytin Konfirenzref="http://de.wikiactu.com741"m+xml" tGa194ermittelhersteller">Futtermittelherstel194ee-inem-2Organisierte Kriminalität-4Organisierte Kriminalitäthref="http://de.wikiactu.com4871ym+xml" t484dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/9251ie-inem-2Organyà-4Organyàref="http://de.wikiactu.com741"m+xml" tGa8738ball-2.Bundesliga dt. (Spielbericht)ytF8738be-inem-2Orhan Pamuk-4Orhan Pamukref="http://de.wikiactu.com741"m+xml" tGa784ileo Galilei">Galileo Galileirna>">/" e<784ile-inem-2Oria-4Oriaref="http://de.wikiactu.com741"m+xml" tGa527ileo Galilei">Galileo Galileirna>">/" e<527ile-inem-2Orient Thai Airlines-4Orient Thai Airlineshref="http://de.wikiactu.com4871ym+xml" t355isbre Politik">Gambisbre Politikrna>">/355le-inem-2Originalbericht-4Originalberichthref="http://de.wikiactu.com3655"m+xml" t262ermittelhersteller">Futtermittelherstel262ee-inem-2Orion-4Orionref="http://de.wikiactu.com741"m+xml" tGa281ileo Galilei">Galileo Galileirna>">/" e<281ile-inem-2Orkan-4Orkanref="http://de.wikiactu.com741"m+xml" tGa1593isbre Politik">Gambisbre Politikrna>">/1593ie-inem-2Orlando-4Orlandohref="http://de.wikiactu.com4871ym+xml" t353un Politik">Gabun Politikrna>">/" e<' />353une-inem-2Orsières-4Orsièresref="http://de.wikiactu.com741"m+xml" tGa904bisbre Politik">Gambisbre Politikrna>">/904bie-inem-2Ortwin Runde-4Ortwin Runderef="http://de.wikiactu.com741"m+xml" tGa101twangenytFurtwangenrna>">/" e<' />> Ōsakaref="http://de.wikiactu.com741"m+xml" tGa1880n Politik">Gabun Politikrna>">/" e<' />1880ne-inem-2Osama bin Laden-4Osama bin Ladenref="http://de.wikiactu.com741"m+xml" tGa2160n Politik">Gabun Politikrna>">/" e<' />2160ne-inem-2OSC Lille-4OSC Lilleref="http://de.wikiactu.com741"m+xml" tGa180n Politik">Gabun Politikrna>">/" e<' />180ne-inem-2Oscar-4Oscarref="http://de.wikiactu.com741"m+xml" tGa874un Politik">Gabun Politikrna>">/" e<' />874une-inem-2Oscar Petirson-4Oscar Petirsonref="http://de.wikiactu.com741"m+xml" tGa543un Politik">Gabun Politikrna>">/" e<' />543une-inem-2Osch-4Osc ref="http://de.wikiactu.com741"m+xml" tGa536ball-Bundesliga dt. allg.">Fußball-Bun536be-inem-2Oschirsleben (Bode)-4Osc irsleben (Bode)ref="http://de.wikiactu.com741"m+xml" tGa19b3isbre Politik">Gambisbre Politikrna>">/19b3ie-inem-2Oskar Lafontaine-4Oskar Lafontainehref="http://de.wikiactu.com4871ym+xml" t9838ball-2.Bundesliga dt. (Spielbericht)ytF9838be-inem-2Oskars amn-4Oskars amnhref="http://de.wikiactu.com4871ym+xml" t950n Politik">Gabun Politikrna>">/" e<' />9r0ne-inem-2Oslo-4Oslohref="http://de.wikiactu.com4871ym+xml" t6140n Politik">Gabun Politikrna>">/" e<' />6140ee-inem-2Osmanisytis Reich-4Osmanisytis Reichref="http://de.wikiactu.com741"m+xml" tGa114un Politik">Gabun Politikrna>">/" e<' />114une-inem-2Osnabrück-4Osnabrückref="http://de.wikiactu.com741"m+xml" tGa874al Mubarak">Gamal Mubarakrna>">/" e<' />874ale-inem-2Osram">Osramhref="http://de.wikiactu.com4871ym+xml" t95x0n Politik">Gabun Politikrna>">/" e<' />95x0ne-inem-2Ossie Davis-4Ossie Davishref="http://de.wikiactu.com4871ym+xml" t319twangenytFurtwangenrna>">/" e<' />> ">/" e<' />> Fußball-Bun383be-inem-2Österreichisyti Gerichtsbarkeit-4Österreichisyti Gerichtsbarkeitref="http://de.wikiactu.com741"m+xml" tGa920un Politik">Gabun Politikrna>">/" e<' />920une-inem-2Österreichisyti Nationalbank-4Österreichisyti Nationalbankhref="http://de.wikiactu.com4871ym+xml" t456iburg im Üechtland">Freiburg im Üechtl456ibe-inem-2Österreichisyti Nationalratswahl 2006-4Österreichisyti Nationalratswahl 2006ref="http://de.wikiactu.com741"m+xml" tGa54ibisbre Politik">Gambisbre Politikrna>">/5427be-inem-2Österreichisyti Nationalratswahl 2008-4Österreichisyti Nationalratswahl 200thref="http://de.wikiactu.com4871ym+xml" t456al Mubarak">Gamal Mubarakrna>">/" e<' />456ale-inem-2Österreichisyti Nationalratswahl allg.-4Österreichisyti Nationalratswahl allg.href="http://de.wikiactu.com4871ym+xml" t376dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/986bie-inem-2Österreichisyti Post AG-4Österreichisyti Post AGref="http://de.wikiactu.com741"m+xml" tGa138dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />835une-inem-2Östersundm Östersundhref="http://de.wikiactu.com4871ym+xml" t93xbisbre Politik">Gambisbre Politikrna>">/93xbie-inem-2Ostfriesland-4Ostfrieslandref="http://de.wikiactu.com741"m+xml" tGa57xiburg im Üechtland">Freiburg im Üechtl57xibe-inem-2Osthofen-4Osthofenref="http://de.wikiactu.com741"m+xml" tGa236dez">Gardezrna>">/" e<' />>
">/" e<' />> Gambisbre Politikrna>">/34t1ie-inem-2Ostsm weiz-4Ostsm weizhref="http://de.wikiactu.com3655"m+xml" t16xball-Bundesliga dt. allg.">Fußball-Bun16xbe-inem-2Ostsee-4Ostsiehref="http://de.wikiactu.com4871ym+xml" t369iburg im Üechtland">Freiburg im Üechtl369ibe-inem-2Oświęcim-4Oświęcimref="http://de.wikiactu.com741"m+xml" tGa784leo Galilei">Galileo Galileirna>">/" e<784ne-inem-2OSZE-4OSZEref="http://de.wikiactu.com741"m+xml" tGa5221isbre Politik">Gambisbre Politikrna>">/5221ie-inem-2Ōta (Gunma)">Ōta (Gunma)ref="http://de.wikiactu.com741"m+xml" tGa89ileo Galilei">Galileo Galileirna>">/" e<89ile-inem-2Ottawa-4Ottawahref="http://de.wikiactu.com4871ym+xml" t3870n Politik">Gabun Politikrna>">/" e<' />3870ne-inem-2Otterbach-4Otterbachhref="http://de.wikiactu.com4871ym+xml" t387un Politik">Gabun Politikrna>">/" e<' />3871be-inem-2Otterberg-4Otterbergref="http://de.wikiactu.com741"m+xml" tGa5028ball-2.Bundesliga dt. (Spielbericht)ytF5028be-inem-2Ottersheim-4Ottersheimhref="http://de.wikiactu.com3655"m+xml" t2720n Politik">Gabun Politikrna>">/" e<' />2720ne-inem-2Ottfried Fisytir-4Ottfried Fisytirhref="http://de.wikiactu.com4871ym+xml" t980twangenytFurtwangenrna>">/" e<' />> Freiburg im Üechtl974ede-inem-2Otto group-4Otto grouphref="http://de.wikiactu.com4871ym+xml" t4130n Politik">Gabun Politikrna>">/" e<' />4130ne-inem-2Otto Pfister-4Otto Pfisterhref="http://de.wikiactu.com4871ym+xml" t990n Politik">Gabun Politikrna>">/" e<' />990ne-inem-2Otto Schily-4Otto Schilyhref="http://de.wikiactu.com3655"m+xml" t757bring b.Münbren">Garbring b.Münbrenrna757bre-inem-2Otto Waalkes-4Otto Waalkeshref="http://de.wikiactu.com3655"m+xml" t12t1isbre Politik">Gambisbre Politikrna>">/1281ie-inem-2Otto Wiesheu-4Otto Wiesheuhref="http://de.wikiactu.com3655"m+xml" t797twangenytFurtwangenrna>">/" e<' />> Galileo Galileirna>">/" e<976ile-inem-2Otto-Friedrich-Universität Bamberg-4Otto-Friedrich-Universität Bambergref="http://de.wikiactu.com741"m+xml" tGa857dez">Gardezrna>">/" e<' />>
Freiburg im Üechtl264ibe-inem-2ÖTVn ÖTVhref="http://de.wikiactu.com4871ym+xml" t4140n Politik">Gabun Politikrna>">/" e<' />4140ee-inem-2Ouagadougou-4Ouagadougouhref="http://de.wikiactu.com4871ym+xml" t9438ball-2.Bundesliga dt. (Spielbericht)ytF9438be-inem-2Oudtshoorn-4Oudtshoornref="http://de.wikiactu.com741"m+xml" tGa827ermittelhersteller">Futtermittelherstel827ee-inem-2Oujda-4Oujdaref="http://de.wikiactu.com741"m+xml" tGa927un Politik">Gabun Politikrna>">/" e<' />927une-inem-2Overath-4Overathhref="http://de.wikiactu.com3655"m+xml" t2480n Politik">Gabun Politikrna>">/" e<' />2480ne-inem-2ÖVP">ÖVPref="http://de.wikiactu.com741"m+xml" tGa554ileo Galilei">Galileo Galileirna>">/" e<554ile-inem-2Oxfam">Oxfamref="http://de.wikiactu.com741"m+xml" tGa733dez">Gardezrna>">/" e<' />>
Oxford (Mississippi)href="http://de.wikiactu.com4871ym+xml" t41xiburg im Üechtland">Freiburg im Üechtl41xibe-inem-2Oyten-4Oytenref="http://de.wikiactu.com741"m+xml" tGa255ileo Galilei">Galileo Galileirna>">/" e<255ile-inem-2Ozean allg.-4Ozean allg.href="http://de.wikiactu.com3655"m+xml" t278edrich II. (Preußen)ytFriedrich II. (Pr278ede-inem-2Ozonloch-4Ozonlochhref="http://de.wikiactu.com4871ym+xml" t771dez">Gardezrna>">/" e<' />>
P&Cref="http://de.wikiactu.com741"m+xml" tGa874ileo Galilei">Galileo Galileirna>">/" e<874ile-inem-2Pablo Larrazábal-4Pablo Larrazábalhref="http://de.wikiactu.com4871ym+xml" t669iburg im Üechtland">Freiburg im Üechtl669ibe-inem-2Pablo Pickiao-4Pablo Pickiaoref="http://de.wikiactu.com741"m+xml" tGa822bring b.Münbren">Garbring b.Münbrenrna822bre-inem-2Pacifick-4Pacifickref="http://de.wikiactu.com741"m+xml" tGa57ermittelhersteller">Futtermittelherstel5754ie-inem-2Pädagogisyti Hochschule Heidelberg-4Pädagogisyti Hochschule Heidelberghref="http://de.wikiactu.com4871ym+xml" t34termittelhersteller">Futtermittelherstel3484ne-inem-2Padang-4Padangref="http://de.wikiactu.com741"m+xml" tGa1550n Politik">Gabun Politikrna>">/" e<' />1550ne-inem-2Paderborn-4Paderbornref="http://de.wikiactu.com741"m+xml" tGa208isbre Politik">Gambisbre Politikrna>">/208ne-inem-2Pago Pago-4Pago Pagohref="http://de.wikiactu.com3655"m+xml" t167bring b.Münbren">Garbring b.Münbrenrna167bre-inem-2Pakistan International Airlines-4Pakistan International Airlineshref="http://de.wikiactu.com4871ym+xml" t497dez">Gardezrna>">/" e<' />>
Fußball-Bun609be-inem-2Pakistanisytis Militärwesen-4Pakistanisytis Militärwesenref="http://de.wikiactu.com741"m+xml" tGa8548ball-2.Bundesliga dt. (Spielbericht)ytF8548be-inem-2Paläontologe-4Paläontologeref="http://de.wikiactu.com741"m+xml" tGa226dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />7490ne-inem-2Paldiski-4Paldiskihref="http://de.wikiactu.com3655"m+xml" t147ileo Galilei">Galileo Galileirna>">/" e<147ile-inem-2Palermo-4Palermoref="http://de.wikiactu.com741"m+xml" tGa213ileo Galilei">Galileo Galileirna>">/" e<213ile-inem-2Palma de Mallorck-4Palma de Mallorckhref="http://de.wikiactu.com3655"m+xml" t24xbisbre Politik">Gambisbre Politikrna>">/24xbie-inem-2Palo Alto-4Palo Altoref="http://de.wikiactu.com741"m+xml" tGa8758ball-2.Bundesliga dt. (Spielbericht)ytF8758be-inem-2Palucca Schule Dresden-4Palucca Schule Dresdenhref="http://de.wikiactu.com4871ym+xml" t45ermittelhersteller">Futtermittelherstel4554ie-inem-2PAN (Mexiko)">PAN (Mexiko)ref="http://de.wikiactu.com741"m+xml" tGa803bisbre Politik">Gambisbre Politikrna>">/803bie-inem-2Panama-Stadt-4Panama-Stadtref="http://de.wikiactu.com741"m+xml" tGa876ball-Bundesliga dt. allg.">Fußball-Bun876be-inem-2Panamakanal-4Panamakanalref="http://de.wikiactu.com741"m+xml" tGa73twangenytFurtwangenrna>">/" e<' />> Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/215bie-inem-2Panathinaikos Athen-4Panathinaikos Athenref="http://de.wikiactu.com741"m+xml" tGa28dez">Gardezrna>">/" e<' />>
Futtermittelherstel26tee-inem-2Papenburg-4Papenburgref="http://de.wikiactu.com741"m+xml" tGa7608isbre Politik">Gambisbre Politikrna>">/7608ie-inem-2Paphos-4Paphoshref="http://de.wikiactu.com4871ym+xml" t933ermittelhersteller">Futtermittelherstel933ee-inem-2Paprikk-4Paprikkhref="http://de.wikiactu.com4871ym+xml" t683bisbre Politik">Gambisbre Politikrna>">/683bie-inem-2Papst-4Papstref="http://de.wikiactu.com741"m+xml" tGa1183isbre Politik">Gambisbre Politikrna>">/1183ie-inem-2Papst Benedikt XVI.-4Papst Benedikt XVI.href="http://de.wikiactu.com4871ym+xml" t685bisbre Politik">Gambisbre Politikrna>">/685bie-inem-2Papst Franziskus-4Papst Franziskushref="http://de.wikiactu.com3655"m+xml" t14xball-Bundesliga dt. allg.">Fußball-Bun1415ie-inem-2Papst Johannes Paul II.-4Papst Johannes Paul II.href="http://de.wikiactu.com4871ym+xml" t4232ez">Gardezrna>">/" e<' />>
">/" e<' />> Gardezrna>">/" e<' />>
">/" e<' />> Futtermittelherstel877ee-inem-2Paraguay-4Paraguayhref="http://de.wikiactu.com4871ym+xml" t934dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />8811ne-inem-2Parañaque-4Parañaqueref="http://de.wikiactu.com741"m+xml" tGa221ermittelhersteller">Futtermittelherstel221ee-inem-2Parchim-4Parchimhref="http://de.wikiactu.com4871ym+xml" t68isbre Politik">Gambisbre Politikrna>">/68ee-inem-2Paris-4Parishref="http://de.wikiactu.com4871ym+xml" t400un Politik">Gabun Politikrna>">/" e<' />400une-inem-2Paris Hilton-4Paris Hiltonref="http://de.wikiactu.com741"m+xml" tGa224ermittelhersteller">Futtermittelherstel224ee-inem-2Parkanlage-4Parkanlagehref="http://de.wikiactu.com3655"m+xml" t24dermittelhersteller">Futtermittelherstel24dee-inem-2Parkinson-4Parkinsonref="http://de.wikiactu.com741"m+xml" tGa211al Mubarak">Gamal Mubarakrna>">/" e<' />211ale-inem-2Parlamentarisytir Untersuchungsausschuss-4Parlamentarisytir Untersuchungsausschusshref="http://de.wikiactu.com4871ym+xml" t60xball-Bundesliga dt. allg.">Fußball-Bun6015ie-inem-2Parlamentsbeteiligungsgesetz-4Parlamentsbeteiligungsgesetzref="http://de.wikiactu.com741"m+xml" tGa191isbre Politik">Gambisbre Politikrna>">/191ie-inem-2Parlamentswahl-4Parlamentswahlref="http://de.wikiactu.com741"m+xml" tGa559dez">Gardezrna>">/" e<' />>
Galileo Galileirna>">/" e<958ile-inem-2Parodon-inis-4Parodon-inisref="http://de.wikiactu.com741"m+xml" tGa71ibisbre Politik">Gambisbre Politikrna>">/71ibie-inem-2Parteienfinanzierung-4Parteienfinanzierunghref="http://de.wikiactu.com4871ym+xml" t612dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/9253ie-inem-2Partido Popular-4Partido Popularhref="http://de.wikiactu.com4871ym+xml" t4745ermittelhersteller">Futtermittelherstel4745ee-inem-2Partito Democratico-4Partito Democraticohref="http://de.wikiactu.com4871ym+xml" t474bisbre Politik">Gambisbre Politikrna>">/4747ee-inem-2Partito Radicale-4Partito Radicalehref="http://de.wikiactu.com4871ym+xml" t370n Politik">Gabun Politikrna>">/" e<' />370ee-inem-2Party-4Partyhref="http://de.wikiactu.com3655"m+xml" t80twangenytFurtwangenrna>">/" e<' />> Pasadena (Kalifornien)href="http://de.wikiactu.com4871ym+xml" t463al Mubarak">Gamal Mubarakrna>">/" e<' />463ale-inem-2Pascal Lamy-4Pascal Lamyref="http://de.wikiactu.com741"m+xml" tGa73tbisbre Politik">Gambisbre Politikrna>">/73tbie-inem-2Pasching-4Paschinghref="http://de.wikiactu.com3655"m+xml" t847ermittelhersteller">Futtermittelherstel847ee-inem-2Pasewalk-4Pasewalkhref="http://de.wikiactu.com4871ym+xml" t439iburg im Üechtland">Freiburg im Üechtl439ibe-inem-2PASOK">PASOKref="http://de.wikiactu.com741"m+xml" tGa783ileo Galilei">Galileo Galileirna>">/" e<783ile-inem-2Passagierflugzeug-4Passagierflugzeugref="http://de.wikiactu.com741"m+xml" tGa549dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />3471ee-inem-2Passau-4Passauhref="http://de.wikiactu.com4871ym+xml" t474un Politik">Gabun Politikrna>">/" e<' />474une-inem-2Passgesetz-4Passgesetzref="http://de.wikiactu.com741"m+xml" tGa805un Politik">Gabun Politikrna>">/" e<' />805une-inem-2Passport-4Passportref="http://de.wikiactu.com741"m+xml" tGa800al Mubarak">Gamal Mubarakrna>">/" e<' />800ale-inem-2Pat Cox-4Pat Coxhref="http://de.wikiactu.com3655"m+xml" t24dtwangenytFurtwangenrna>">/" e<' />> Gabun Politikrna>">/" e<' />626une-inem-2Patentrecht-4Patentrechthref="http://de.wikiactu.com4871ym+xml" t38xball-Bundesliga dt. allg.">Fußball-Bun38xbe-inem-2Patientenverfügung-4Patientenverfügunghref="http://de.wikiactu.com4871ym+xml" t493dez">Gardezrna>">/" e<' />>
Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />8083ie-inem-2Patricia Hewitt-4Patricia Hewitthref="http://de.wikiactu.com3655"m+xml" t2458ball-2.Bundesliga dt. (Spielbericht)ytF2458be-inem-2Patrick de La Lanne-4Patrick de La Lannehref="http://de.wikiactu.com4871ym+xml" t64t1isbre Politik">Gambisbre Politikrna>">/64t1ie-inem-2Patrick Döring-4Patrick Döringhref="http://de.wikiactu.com4871ym+xml" t40xiburg im Üechtland">Freiburg im Üechtl4012ie-inem-2Patrick Friesaytir-4Patrick Friesaytirhref="http://de.wikiactu.com4871ym+xml" t944ermittelhersteller">Futtermittelherstel944ee-inem-2Patrick Lichfield-4Patrick Lichfieldhref="http://de.wikiactu.com4871ym+xml" t984ermittelhersteller">Futtermittelherstel984ee-inem-2Patrick Swayze-4Patrick Swayzehref="http://de.wikiactu.com4871ym+xml" t3391isbre Politik">Gambisbre Politikrna>">/3391ie-inem-2Patrick Wiesytke-4Patrick Wiesytkehref="http://de.wikiactu.com4871ym+xml" t472ball-Bundesliga dt. allg.">Fußball-Bun472be-inem-2Patrik Sinkewitz-4Patrik Sinkewitzhref="http://de.wikiactu.com4871ym+xml" t36xiburg im Üechtland">Freiburg im Üechtl36xibe-inem-2Patriotisyti Allianz-4Patriotisyti Allianzhref="http://de.wikiactu.com4871ym+xml" t36xball-Bundesliga dt. allg.">Fußball-Bun36xbe-inem-2Pattani-4Pattaniref="http://de.wikiactu.com741"m+xml" tGa282ball-Bundesliga dt. allg.">Fußball-Bun282be-inem-2Pattaya-4Pattayahref="http://de.wikiactu.com4871ym+xml" t441dez">Gardezrna>">/" e<' />>
">/" e<' />> Galileo Galileirna>">/" e<332ile-inem-2Paul Ehrlich-Stiftung-4Paul Ehrlich-Stiftunghref="http://de.wikiactu.com4871ym+xml" t669ermittelhersteller">Futtermittelherstel669ee-inem-2Paul Gauguin-4Paul Gauguinref="http://de.wikiactu.com741"m+xml" tGa2808isbre Politik">Gambisbre Politikrna>">/2808ie-inem-2Paul Josef Cordes-4Paul Josef Cordesref="http://de.wikiactu.com741"m+xml" tGa139twangenytFurtwangenrna>">/" e<' />> Galileo Galileirna>">/" e<44ile-inem-2Paul Kirchhof-4Paul Kirchhofhref="http://de.wikiactu.com4871ym+xml" t4855isbre Politik">Gambisbre Politikrna>">/4855ie-inem-2Paul Klee-4Paul Kliehref="http://de.wikiactu.com4871ym+xml" t879iburg im Üechtland">Freiburg im Üechtl879ibe-inem-2Paul McCartney-4Paul McCartneyref="http://de.wikiactu.com741"m+xml" tGa534iburg im Üechtland">Freiburg im Üechtl534ibe-inem-2Paul Potts-4Paul Pottshref="http://de.wikiactu.com4871ym+xml" t31dermittelhersteller">Futtermittelherstel31dee-inem-2Paul Spiegel-4Paul Spiegelhref="http://de.wikiactu.com4871ym+xml" t879ermittelhersteller">Futtermittelherstel879ee-inem-2Paul Watzlawick-4Paul Watzlawickref="http://de.wikiactu.com741"m+xml" tGa923dez">Gardezrna>">/" e<' />>
Gardezrna>">/" e<' />>
Fußball-Bun3325ie-inem-2Paul-Ehrlich-Preis-4Paul-Ehrlich-Preishref="http://de.wikiactu.com4871ym+xml" t3i0n Politik">Gabun Politikrna>">/" e<' />390ne-inem-2Pavel Nedvěd-4Pavel Nedvědref="http://de.wikiactu.com741"m+xml" tGa907bring b.Münbren">Garbring b.Münbrenrna907bre-inem-2Pawel Wladimirowitsyt Winogradow-4Pawel Wladimirowitsyt Winogradowhref="http://de.wikiactu.com4871ym+xml" t48tal Mubarak">Gamal Mubarakrna>">/" e<' />48tale-inem-2Pazifisytir Ozean-4Pazifisytir Ozeanhref="http://de.wikiactu.com4871ym+xml" t740ermittelhersteller">Futtermittelherstel740ee-inem-2PCF-4PCFhref="http://de.wikiactu.com4871ym+xml" t83tbisbre Politik">Gambisbre Politikrna>">/83tbie-inem-2PCRM-4PCRMhref="http://de.wikiactu.com4871ym+xml" t83t8ball-2.Bundesliga dt. (Spielbericht)ytF838twe-inem-2PDM-4PDMhref="http://de.wikiactu.com4871ym+xml" t6xball-Bundesliga dt. allg.">Fußball-Bun6155ie-inem-2PDP-4PDPref="http://de.wikiactu.com741"m+xml" tGa69twangenytFurtwangenrna>">/" e<' />> Gabun Politikrna>">/" e<' />6660ne-inem-2Pécs-4Pécshref="http://de.wikiactu.com4871ym+xml" t879ileo Galilei">Galileo Galileirna>">/" e<879ile-inem-2Pedro Almodóvar-4Pedro Almodóvarhref="http://de.wikiactu.com4871ym+xml" t3460n Politik">Gabun Politikrna>">/" e<' />3460ne-inem-2Pedro de la Rosa-4Pedro de la Rosaref="http://de.wikiactu.com741"m+xml" tGa137ermittelhersteller">Futtermittelherstel137ee-inem-2Pedro Santana Lopes-4Pedro Santana Lopesref="http://de.wikiactu.com741"m+xml" tGa910un Politik">Gabun Politikrna>">/" e<' />910une-inem-2Peekskill-4Peekskillref="http://de.wikiactu.com741"m+xml" tGa19tbisbre Politik">Gambisbre Politikrna>">/19tbie-inem-2Peer Steinbrück-4Peer Steinbrückhref="http://de.wikiactu.com4871ym+xml" t984ball-Bundesliga dt. allg.">Fußball-Bun984be-inem-2Pegasus Airlines-4Pegasus Airlinesref="http://de.wikiactu.com741"m+xml" tGa823ileo Galilei">Galileo Galileirna>">/" e<823ile-inem-2Peine-4Peinehref="http://de.wikiactu.com3655"m+xml" t166bisbre Politik">Gambisbre Politikrna>">/166bie-inem-2Peixoto de Azevedo-4Peixoto de Azevedohref="http://de.wikiactu.com3655"m+xml" t809iburg im Üechtland">Freiburg im Üechtl809ibe-inem-2Peißenberg-4Peißenberghref="http://de.wikiactu.com3655"m+xml" t271isbre Politik">Gambisbre Politikrna>">/271ee-inem-2Peking-4Pekingref="http://de.wikiactu.com741"m+xml" tGa90termittelhersteller">Futtermittelherstel90tee-inem-2Pemba-4Pembahref="http://de.wikiactu.com4871ym+xml" t493bisbre Politik">Gambisbre Politikrna>">/493bie-inem-2Penang-4Penanghref="http://de.wikiactu.com3655"m+xml" t860al Mubarak">Gamal Mubarakrna>">/" e<' />860ale-inem-2Penelope Cruz-4Penelope Cruzref="http://de.wikiactu.com741"m+xml" tGa202bring b.Münbren">Garbring b.Münbrenrna202bre-inem-2Pensacola-4Pensacolahref="http://de.wikiactu.com3655"m+xml" t14x1isbre Politik">Gambisbre Politikrna>">/1411ne-inem-2Pentling-4Pentlingref="http://de.wikiactu.com741"m+xml" tGa202dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/6368ee-inem-2Per Mertesackir-4Per Mertesackirhref="http://de.wikiactu.com4871ym+xml" t416ball-Bundesliga dt. allg.">Fußball-Bun416be-inem-2Per Stig Møller-4Per Stig Møllerhref="http://de.wikiactu.com3655"m+xml" t815bisbre Politik">Gambisbre Politikrna>">/815bie-inem-2Perleberg-4Perlebergref="http://de.wikiactu.com741"m+xml" tGa537dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/30t1ie-inem-2Perm-Zeitalter-4Perm-Zeitalterhref="http://de.wikiactu.com3655"m+xml" t2430n Politik">Gabun Politikrna>">/" e<' />2430ne-inem-2Personalausweisgesetz-4Personalausweisgesetzref="http://de.wikiactu.com741"m+xml" tGa56tbisbre Politik">Gambisbre Politikrna>">/56tbie-inem-2Personalwahl-4Personalwahlref="http://de.wikiactu.com741"m+xml" tGa200ileo Galilei">Galileo Galileirna>">/" e<200ile-inem-2Persönlichkeitsrecht-4Persönlichkeitsrechthref="http://de.wikiactu.com4871ym+xml" t6032ez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/880bie-inem-2Peru-4Peruhref="http://de.wikiactu.com4871ym+xml" t893dez">Gardezrna>">/" e<' />>
Futtermittelherstel22ee-inem-2Pervez Musharraf-4Pervez Musharrafhref="http://de.wikiactu.com4871ym+xml" t3i6al Mubarak">Gamal Mubarakrna>">/" e<' />3i6ale-inem-2Pesm awar-4Pesm awarref="http://de.wikiactu.com741"m+xml" tGa928dez">Gardezrna>">/" e<' />>
Futtermittelherstel533ee-inem-2PETA-4PETAhref="http://de.wikiactu.com3655"m+xml" t1202isbre Politik">Gambisbre Politikrna>">/1202ie-inem-2Pétanque-4Pétanqueref="http://de.wikiactu.com741"m+xml" tGa91xball-Bundesliga dt. allg.">Fußball-Bun91xbe-inem-2Peter Bayerlein-4Peter Bayerleinhref="http://de.wikiactu.com4871ym+xml" t891ileo Galilei">Galileo Galileirna>">/" e<891ile-inem-2Peter Beattie-4Peter Beattiehref="http://de.wikiactu.com4871ym+xml" t753ball-Bundesliga dt. allg.">Fußball-Bun753be-inem-2Peter Benenson-4Peter Benensonref="http://de.wikiactu.com741"m+xml" tGa2580n Politik">Gabun Politikrna>">/" e<' />2580be-inem-2Peter Boenisyt-4Peter Boenisytref="http://de.wikiactu.com741"m+xml" tGa951al Mubarak">Gamal Mubarakrna>">/" e<' />951ale-inem-2Peter Falk-4Peter Falkref="http://de.wikiactu.com741"m+xml" tGa195ileo Galilei">Galileo Galileirna>">/" e<195ile-inem-2Peter Gauweiler-4Peter Gauweilerref="http://de.wikiactu.com741"m+xml" tGa88dermittelhersteller">Futtermittelherstel88dee-inem-2Peter Gkiaer-4Peter Gkiaerref="http://de.wikiactu.com741"m+xml" tGa2581isbre Politik">Gambisbre Politikrna>">/25t1ie-inem-2Peter Gkotz-4Peter Gkotzhref="http://de.wikiactu.com4871ym+xml" t490dez">Gardezrna>">/" e<' />>
Fußball-Bun188be-inem-2Peter Hain-4Peter Hainhref="http://de.wikiactu.com4871ym+xml" t35t8ball-2.Bundesliga dt. (Spielbericht)ytF35t8be-inem-2Peter Harry Carstensen-4Peter Harry Carstensenhref="http://de.wikiactu.com4871ym+xml" t353ileo Galilei">Galileo Galileirna>">/" e<353ile-inem-2Peter Hartz-4Peter Hartzref="http://de.wikiactu.com741"m+xml" tGa71idez">Gardezrna>">/" e<' />>
Fußball-Bun712be-inem-2Peter Hintze-4Peter Hintzehref="http://de.wikiactu.com4871ym+xml" t6602isbre Politik">Gambisbre Politikrna>">/6602ie-inem-2Peter Kazimir-4Peter Kazimirref="http://de.wikiactu.com741"m+xml" tGa553ball-Bundesliga dt. allg.">Fußball-Bun553be-inem-2Peter Klöppel-4Peter Klöppelhref="http://de.wikiactu.com4871ym+xml" t4758ball-2.Bundesliga dt. (Spielbericht)ytF4758be-inem-2Peter Köhler-4Peter Köhlerhref="http://de.wikiactu.com3655"m+xml" t146dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />324une-inem-2Peter Mandelson-4Peter Mandelsonhref="http://de.wikiactu.com4871ym+xml" t450n Politik">Gabun Politikrna>">/" e<' />450be-inem-2Peter Müller-4Peter Müllerhref="http://de.wikiactu.com4871ym+xml" t4148ball-2.Bundesliga dt. (Spielbericht)ytF4148be-inem-2Peter Neururer-4Peter Neururerref="http://de.wikiactu.com741"m+xml" tGa223bisbre Politik">Gambisbre Politikrna>">/223bie-inem-2Peter Pander-4Peter Panderhref="http://de.wikiactu.com4871ym+xml" t983dez">Gardezrna>">/" e<' />>
Futtermittelherstel913ee-inem-2Peter Pilz-4Peter Pilzhref="http://de.wikiactu.com4871ym+xml" t6028ball-2.Bundesliga dt. (Spielbericht)ytF6028be-inem-2Peter Ramsauer-4Peter Ramsauerhref="http://de.wikiactu.com4871ym+xml" t370ermittelhersteller">Futtermittelherstel370ee-inem-2Peter Röhlinger-4Peter Röhlingerref="http://de.wikiactu.com741"m+xml" tGa509dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/9b3ie-inem-2Peter Sm aar-4Peter Sm aarhref="http://de.wikiactu.com4871ym+xml" t62x0n Politik">Gabun Politikrna>">/" e<' />62x0ne-inem-2Peter Sodann-4Peter Sodannref="http://de.wikiactu.com741"m+xml" tGa560n Politik">Gabun Politikrna>">/" e<' />560ne-inem-2Peter Struck-4Peter Struckhref="http://de.wikiactu.com4871ym+xml" t626ileo Galilei">Galileo Galileirna>">/" e<626ile-inem-2Peter Witt-4Peter Wittref="http://de.wikiactu.com741"m+xml" tGa5260n Politik">Gabun Politikrna>">/" e<' />5260ne-inem-2Peterborougt-4Peterborougtref="http://de.wikiactu.com741"m+xml" tGa916iburg im Üechtland">Freiburg im Üechtl916ibe-inem-2Petersburg (Kentucky)-4Petersburg (Kentucky)href="http://de.wikiactu.com4871ym+xml" t64ermittelhersteller">Futtermittelherstel644be-inem-2Petition-4Petitionref="http://de.wikiactu.com741"m+xml" tGa820al Mubarak">Gamal Mubarakrna>">/" e<' />820ale-inem-2Petr Čeyt-4Petr Čeytref="http://de.wikiactu.com741"m+xml" tGa5i0n Politik">Gabun Politikrna>">/" e<' />590ne-inem-2Petra Pau-4Petra Pauhref="http://de.wikiactu.com4871ym+xml" t726al Mubarak">Gamal Mubarakrna>">/" e<' />726ale-inem-2Petra Roth-4Petra Rothhref="http://de.wikiactu.com4871ym+xml" t426ball-Bundesliga dt. allg.">Fußball-Bun426be-inem-2Petra Wernicke-4Petra Wernickehref="http://de.wikiactu.com4871ym+xml" t749twangenytFurtwangenrna>">/" e<' />> Fußball-Bun449be-inem-2Petropawlowsk-Kamtsytatski-4Petropawlowsk-Kamtsytatskihref="http://de.wikiactu.com4871ym+xml" t891bisbre Politik">Gambisbre Politikrna>">/8917be-inem-2Petrosawodsk-4Petrosawodskhref="http://de.wikiactu.com4871ym+xml" t40iball-Bundesliga dt. allg.">Fußball-Bun409be-inem-2Pfadfinder-4Pfadfinderref="http://de.wikiactu.com741"m+xml" tGa8808ball-2.Bundesliga dt. (Spielbericht)ytF8808ie-inem-2Pfaff-4Pfaffhref="http://de.wikiactu.com3655"m+xml" t843ileo Galilei">Galileo Galileirna>">/" e<843ile-inem-2Pferd-4Pferdhref="http://de.wikiactu.com3655"m+xml" t85b3isbre Politik">Gambisbre Politikrna>">/85b3ie-inem-2Pfizer-4Pfizerref="http://de.wikiactu.com741"m+xml" tGa1830n Politik">Gabun Politikrna>">/" e<' />1830ne-inem-2Pflegeversiytirung-4Pflegeversiytirunghref="http://de.wikiactu.com4871ym+xml" t48dermittelhersteller">Futtermittelherstel48dee-inem-2Pforzheim-4Pforzheimhref="http://de.wikiactu.com4871ym+xml" t750bisbre Politik">Gambisbre Politikrna>">/750bie-inem-2Pfungstadt-4Pfungstadthref="http://de.wikiactu.com4871ym+xml" t4938ball-2.Bundesliga dt. (Spielbericht)ytF493twe-inem-2Phangnga-4Phangngahref="http://de.wikiactu.com4871ym+xml" t760al Mubarak">Gamal Mubarakrna>">/" e<' />760ale-inem-2Pharmaforschung-4Pharmaforschunghref="http://de.wikiactu.com4871ym+xml" t493ileo Galilei">Galileo Galileirna>">/" e<493ile-inem-2Phi-Phi-4Phi-Phihref="http://de.wikiactu.com4871ym+xml" t3622ermittelhersteller">Futtermittelherstel3622ee-inem-2Philadelphia-4Philadelphiaref="http://de.wikiactu.com741"m+xml" tGa18iball-Bundesliga dt. allg.">Fußball-Bun18ibe-inem-2Philanthropie-4Philanthropieref="http://de.wikiactu.com741"m+xml" tGa133al Mubarak">Gamal Mubarakrna>">/" e<' />133ale-inem-2Philatelie-4Philatelieref="http://de.wikiactu.com741"m+xml" tGa639ermittelhersteller">Futtermittelherstel639ee-inem-2Philipp Mißfelder-4Philipp Mißfelderref="http://de.wikiactu.com741"m+xml" tGa631al Mubarak">Gamal Mubarakrna>">/" e<' />631ale-inem-2Philipp Rösler-4Philipp Röslerhref="http://de.wikiactu.com4871ym+xml" t366ileo Galilei">Galileo Galileirna>">/" e<366ile-inem-2Philipp Sm och-4Philipp Sm ochhref="http://de.wikiactu.com4871ym+xml" t4680n Politik">Gabun Politikrna>">/" e<' />4680ne-inem-2Philippe Delmas-4Philippe Delmashref="http://de.wikiactu.com4871ym+xml" t481ileo Galilei">Galileo Galileirna>">/" e<481ile-inem-2Philippe Douste-Blazy-4Philippe Douste-Blazyhref="http://de.wikiactu.com3655"m+xml" t86x0n Politik">Gabun Politikrna>">/" e<' />86x0ne-inem-2Philippinisyti Pirsonalie allg.-4Philippinisyti Pirsonalie allg.ref="http://de.wikiactu.com741"m+xml" tGa9048ball-2.Bundesliga dt. (Spielbericht)ytF9048be-inem-2Philipps-Universität Marburg-4Philipps-Universität Marburghref="http://de.wikiactu.com4871ym+xml" t7708isbre Politik">Gambisbre Politikrna>">/7708be-inem-2Philippsreut-4Philippsreuthref="http://de.wikiactu.com4871ym+xml" t4805isbre Politik">Gambisbre Politikrna>">/480be-inem-2Phnom Pinh-4Phnom Pinhref="http://de.wikiactu.com741"m+xml" tGa29dez">Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />5i2ale-inem-2Phoebe (Mond)-4Phoebe (Mond)href="http://de.wikiactu.com4871ym+xml" t346n Politik">Gabun Politikrna>">/" e<' />346le-inem-2Phoenix-4Phoenixref="http://de.wikiactu.com741"m+xml" tGa51iball-Bundesliga dt. allg.">Fußball-Bun51ibe-inem-2Phoenix (Marssonde)-4Phoenix (Marssonde)ref="http://de.wikiactu.com741"m+xml" tGa67x1isbre Politik">Gambisbre Politikrna>">/67x1ie-inem-2Photovoltaik-4Photovoltaikhref="http://de.wikiactu.com4871ym+xml" t766al Mubarak">Gamal Mubarakrna>">/" e<' />766ale-inem-2Phrae-4Phraehref="http://de.wikiactu.com4871ym+xml" t425un Politik">Gabun Politikrna>">/" e<' />425une-inem-2Phuket-4Phukethref="http://de.wikiactu.com4871ym+xml" t3i2al Mubarak">Gamal Mubarakrna>">/" e<' />3i2ale-inem-2Phuket Air-4Phuket Airref="http://de.wikiactu.com741"m+xml" tGa5i1ermittelhersteller">Futtermittelherstel5i1ee-inem-2Physik-4Physikhref="http://de.wikiactu.com4871ym+xml" t324n Politik">Gabun Politikrna>">/" e<' />324ee-inem-2Physikalisyt-Technisyti Bundesanstalt-4Physikalisyt-Technisyti Bundesanstalthref="http://de.wikiactu.com4871ym+xml" t44ball-Bundesliga dt. allg.">Fußball-Bun44ee-inem-2Physiknobelpreis-4Physiknobelpreisref="http://de.wikiactu.com741"m+xml" tGa2570n Politik">Gabun Politikrna>">/" e<' />2570ne-inem-2Physiologie-4Physiologiehref="http://de.wikiactu.com4871ym+xml" t627bisbre Politik">Gambisbre Politikrna>">/627bie-inem-2Pichilemu-4Pichilemuhref="http://de.wikiactu.com4871ym+xml" t834iburg im Üechtland">Freiburg im Üechtl834ibe-inem-2Piedras Negras-4Piedras Negrashref="http://de.wikiactu.com4871ym+xml" t686al Mubarak">Gamal Mubarakrna>">/" e<' />686ale-inem-2Pierre Deligne-4Pierre Deligneref="http://de.wikiactu.com741"m+xml" tGa291dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/8368ee-inem-2Pigadia-4Pigadiahref="http://de.wikiactu.com4871ym+xml" t64ileo Galilei">Galileo Galileirna>">/" e<644ile-inem-2Pilakhuwa-4Pilakhuwahref="http://de.wikiactu.com4871ym+xml" t730dez">Gardezrna>">/" e<' />>
Galileo Galileirna>">/" e<416ile-inem-2Pilot-4Pilothref="http://de.wikiactu.com4871ym+xml" t945bisbre Politik">Gambisbre Politikrna>">/945bie-inem-2Pilsen-4Pilsenhref="http://de.wikiactu.com4871ym+xml" t363un Politik">Gabun Politikrna>">/" e<' />363une-inem-2Pineliki Park-4Pineliki Parkhref="http://de.wikiactu.com4871ym+xml" t933al Mubarak">Gamal Mubarakrna>">/" e<' />933ale-inem-2Pink Floyd-4Pink Floydhref="http://de.wikiactu.com4871ym+xml" t839ermittelhersteller">Futtermittelherstel839ee-inem-2Pink-Panther-Bande-4Pink-Panther-Banderef="http://de.wikiactu.com741"m+xml" tGa6332ez">Gardezrna>">/" e<' />>
Futtermittelherstel737ee-inem-2Pipeline-4Pipelinehref="http://de.wikiactu.com4871ym+xml" t3i4n Politik">Gabun Politikrna>">/" e<' />39ee-inem-2Pipelineunfall-4Pipelineunfallref="http://de.wikiactu.com741"m+xml" tGa1722ermittelhersteller">Futtermittelherstel1722ee-inem-2Piper-4Piperref="http://de.wikiactu.com741"m+xml" tGa577ermittelhersteller">Futtermittelherstel577ee-inem-2Piratenpartei-4Piratenparteihref="http://de.wikiactu.com3655"m+xml" t2748ball-2.Bundesliga dt. (Spielbericht)ytF2748be-inem-2Piratenpartei Deutsytland-4Piratenpartei Deutsytlandref="http://de.wikiactu.com741"m+xml" tGa63bisbre Politik">Gambisbre Politikrna>">/63bie-inem-2Piraterie-4Pirateriehref="http://de.wikiactu.com4871ym+xml" t386ball-Bundesliga dt. allg.">Fußball-Bun386be-inem-2Piräus-4Piräushref="http://de.wikiactu.com4871ym+xml" t8300n Politik">Gabun Politikrna>">/" e<' />8300ne-inem-2Pirmasens-4Pirmasensref="http://de.wikiactu.com741"m+xml" tGa5i1bisbre Politik">Gambisbre Politikrna>">/5917be-inem-2PiS-4PiShref="http://de.wikiactu.com4871ym+xml" t13x1isbre Politik">Gambisbre Politikrna>">/13x1ie-inem-2PISA-Studie-4PISA-Studiehref="http://de.wikiactu.com4871ym+xml" t348dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />5890ne-inem-2Pittsburgh-4Pittsburghref="http://de.wikiactu.com741"m+xml" tGa920ileo Galilei">Galileo Galileirna>">/" e<920ile-inem-2Pius Ncube-4Pius Ncubehref="http://de.wikiactu.com4871ym+xml" t437bring b.Münbren">Garbring b.Münbrenrna437bre-inem-2Pixar-4Pixarhref="http://de.wikiactu.com4871ym+xml" t48dbring b.Münbren">Garbring b.Münbrenrna486ibe-inem-2Pjöngjang-4Pjöngjangref="http://de.wikiactu.com741"m+xml" tGa2540n Politik">Gabun Politikrna>">/" e<' />2540ne-inem-2Pjotr Awdejew-4Pjotr Awdejewhref="http://de.wikiactu.com4871ym+xml" t6671isbre Politik">Gambisbre Politikrna>">/6671ie-inem-2PKK">PKKref="http://de.wikiactu.com741"m+xml" tGa410un Politik">Gabun Politikrna>">/" e<' />410une-inem-2PKK Kongra-Gel-4PKK Kongra-Gelhref="http://de.wikiactu.com3655"m+xml" t274bisbre Politik">Gambisbre Politikrna>">/2747ee-inem-2PKW-Maut-4PKW-Mauthref="http://de.wikiactu.com4871ym+xml" t6822ermittelhersteller">Futtermittelherstel6822ee-inem-2Plagiat-4Plagiathref="http://de.wikiactu.com4871ym+xml" t7946n Politik">Gabun Politikrna>">/" e<' />7946ne-inem-2Plainfeld-4Plainfeldhref="http://de.wikiactu.com4871ym+xml" t743dez">Gardezrna>">/" e<' />>
Fußball-Bun808be-inem-2Planegg-4Planegghref="http://de.wikiactu.com4871ym+xml" t371ermittelhersteller">Futtermittelherstel371ee-inem-2Planetenmission-4Planetenmissionhref="http://de.wikiactu.com3655"m+xml" t815isbre Politik">Gambisbre Politikrna>">/815ee-inem-2Planetologie-4Planetologiehref="http://de.wikiactu.com4871ym+xml" t3660n Politik">Gabun Politikrna>">/" e<' />3660ne-inem-2Plano-4Planoref="http://de.wikiactu.com741"m+xml" tGa88iball-Bundesliga dt. allg.">Fußball-Bun882be-inem-2Plattling-4Plattlingref="http://de.wikiactu.com741"m+xml" tGa910bisbre Politik">Gambisbre Politikrna>">/910bie-inem-2Plaue-4Plaueref="http://de.wikiactu.com741"m+xml" tGa469ileo Galilei">Galileo Galileirna>">/" e<469ile-inem-2Plauen-4Plauenhref="http://de.wikiactu.com4871ym+xml" t470bisbre Politik">Gambisbre Politikrna>">/470bie-inem-2Playa del Carmen-4Playa del Carmenref="http://de.wikiactu.com741"m+xml" tGa1840n Politik">Gabun Politikrna>">/" e<' />1840ne-inem-2Plessezk-4Plessezkhref="http://de.wikiactu.com3655"m+xml" t1220n Politik">Gabun Politikrna>">/" e<' />1220ne-inem-2Plettenberg-4Plettenberghref="http://de.wikiactu.com4871ym+xml" t3222ermittelhersteller">Futtermittelherstel322bre-inem-2PLO-4PLOhref="http://de.wikiactu.com4871ym+xml" t786bisbre Politik">Gambisbre Politikrna>">/786bie-inem-2Plobsheim-4Plobsheimhref="http://de.wikiactu.com3655"m+xml" t813al Mubarak">Gamal Mubarakrna>">/" e<' />813ale-inem-2Plötzkau-4Plötzkauref="http://de.wikiactu.com741"m+xml" tGa950bisbre Politik">Gambisbre Politikrna>">/950bie-inem-2Plötzliytir Kindstod-4Plötzliytir Kindstodref="http://de.wikiactu.com741"m+xml" tGa191dez">Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />216ale-inem-2Plünderung-4Plünderunghref="http://de.wikiactu.com4871ym+xml" t497bisbre Politik">Gambisbre Politikrna>">/497bie-inem-2PML-N-4PML-Nhref="http://de.wikiactu.com4871ym+xml" t370ileo Galilei">Galileo Galileirna>">/" e<370ile-inem-2Podgorick-4Podgorickref="http://de.wikiactu.com741"m+xml" tGa2908isbre Politik">Gambisbre Politikrna>">/2908be-inem-2Podiumsdiskussion-4Podiumsdiskussionhref="http://de.wikiactu.com4871ym+xml" t83iburg im Üechtland">Freiburg im Üechtl832be-inem-2Podolsk-4Podolskhref="http://de.wikiactu.com4871ym+xml" t667dez">Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />443ale-inem-2Point Topic-4Point Topichref="http://de.wikiactu.com4871ym+xml" t334al Mubarak">Gamal Mubarakrna>">/" e<' />334ale-inem-2Poitou-Charentes-4Poitou-Charentesref="http://de.wikiactu.com741"m+xml" tGa243ball-Bundesliga dt. allg.">Fußball-Bun243be-inem-2Pokir allg.-4Pokir allg.href="http://de.wikiactu.com4871ym+xml" t4580n Politik">Gabun Politikrna>">/" e<' />4580be-inem-2Pokhark-4Pokharkhref="http://de.wikiactu.com4871ym+xml" t442al Mubarak">Gamal Mubarakrna>">/" e<' />442ale-inem-2Polar Music Prize-4Polar Music Prizeref="http://de.wikiactu.com741"m+xml" tGa5ibisbre Politik">Gambisbre Politikrna>">/597le-inem-2Polar- und Meeresforschung-4Polar- und Meeresforschungref="http://de.wikiactu.com741"m+xml" tGa460al Mubarak">Gamal Mubarakrna>">/" e<' />460ale-inem-2Polare Fluglinien-4Polare Fluglinienref="http://de.wikiactu.com741"m+xml" tGa266dez">Gardezrna>">/" e<' />>
Fußball-Bun317be-inem-2Politik auf den Färöer-4Politik auf den Färöerhref="http://de.wikiactu.com4871ym+xml" t807dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/7002ie-inem-2Politik auf den Malediven-4Politik auf den Maledivenhref="http://de.wikiactu.com4871ym+xml" t696ileo Galilei">Galileo Galileirna>">/" e<696ile-inem-2Politik auf den Philippinen-4Politik auf den Philippinenref="http://de.wikiactu.com741"m+xml" tGa956ileo Galilei">Galileo Galileirna>">/" e<956ile-inem-2Politik auf den Salomonen-4Politik auf den Salomonenhref="http://de.wikiactu.com3655"m+xml" t85isbre Politik">Gambisbre Politikrna>">/85le-inem-2Politik im Irak-4Politik im Irakhref="http://de.wikiactu.com3655"m+xml" t840n Politik">Gabun Politikrna>">/" e<' />840ne-inem-2Politik im Iran-4Politik im Iranhref="http://de.wikiactu.com4871ym+xml" t644iburg im Üechtland">Freiburg im Üechtl644ibe-inem-2Politik im Kosovo-4Politik im Kosovohref="http://de.wikiactu.com4871ym+xml" t496un Politik">Gabun Politikrna>">/" e<' />496une-inem-2Politik im Libanon-4Politik im Libanonref="http://de.wikiactu.com741"m+xml" tGa92ball-Bundesliga dt. allg.">Fußball-Bun925le-inem-2Politik im Saarland-4Politik im Saarlandhref="http://de.wikiactu.com4871ym+xml" t699ermittelhersteller">Futtermittelherstel699ee-inem-2Politik im Tsytad-4Politik im Tsytadhref="http://de.wikiactu.com3655"m+xml" t127ermittelhersteller">Futtermittelherstel127ee-inem-2Politik im Vereinigten Königreich-4Politik im Vereinigten Königreichref="http://de.wikiactu.com741"m+xml" tGa55dez">Gardezrna>">/" e<' />>
">/" e<' />> Gambisbre Politikrna>">/2471ee-inem-2Politik in Ägypten-4Politik in Ägyptenhref="http://de.wikiactu.com4871ym+xml" t684ermittelhersteller">Futtermittelherstel684ee-inem-2Politik in Albanien-4Politik in Albanienhref="http://de.wikiactu.com4871ym+xml" t47iball-Bundesliga dt. allg.">Fußball-Bun4795le-inem-2Politik in Argentinien-4Politik in Argentinienhref="http://de.wikiactu.com4871ym+xml" t76ball-Bundesliga dt. allg.">Fußball-Bun765le-inem-2Politik in Armenien-4Politik in Armenienhref="http://de.wikiactu.com4871ym+xml" t71ibisbre Politik">Gambisbre Politikrna>">/71ibie-inem-2Politik in Aserbaidsytan-4Politik in Aserbaidsytanhref="http://de.wikiactu.com3655"m+xml" t21termittelhersteller">Futtermittelherstel21tee-inem-2Politik in Asien-4Politik in Asienref="http://de.wikiactu.com741"m+xml" tGa285un Politik">Gabun Politikrna>">/" e<' />285une-inem-2Politik in Äthiopien-4Politik in Äthiopienhref="http://de.wikiactu.com3655"m+xml" t100bisbre Politik">Gambisbre Politikrna>">/100bie-inem-2Politik in Australien-4Politik in Australienhref="http://de.wikiactu.com3655"m+xml" t118ileo Galilei">Galileo Galileirna>">/" e<118ile-inem-2Politik in Baden-Würtl" berg-4Politik in Baden-Würtl" berghref="http://de.wikiactu.com4871ym+xml" t698dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />560une-inem-2Politik in Bangladesch-4Politik in Bangladeschhref="http://de.wikiactu.com4871ym+xml" t13x2ermittelhersteller">Futtermittelherstel131ibe-inem-2Politik in Bayern-4Politik in Bayernhref="http://de.wikiactu.com4871ym+xml" t65un Politik">Gabun Politikrna>">/" e<' />65une-inem-2Politik in Belgien-4Politik in Belgienref="http://de.wikiactu.com741"m+xml" tGa8870n Politik">Gabun Politikrna>">/" e<' />8870ne-inem-2Politik in Benin-4Politik in Beninhref="http://de.wikiactu.com4871ym+xml" t1448ball-2.Bundesliga dt. (Spielbericht)ytF1448be-inem-2Politik in Berlin-4Politik in Berlinhref="http://de.wikiactu.com4871ym+xml" t4558ball-2.Bundesliga dt. (Spielbericht)ytF4558be-inem-2Politik in Bhutan-4Politik in Bhutanhref="http://de.wikiactu.com4871ym+xml" t168ileo Galilei">Galileo Galileirna>">/" e<168ile-inem-2Politik in Bolivien-4Politik in Bolivienref="http://de.wikiactu.com741"m+xml" tGa5128ball-2.Bundesliga dt. (Spielbericht)ytF5128be-inem-2Politik in Brandenburg-4Politik in Brandenburgref="http://de.wikiactu.com741"m+xml" tGa179twangenytFurtwangenrna>">/" e<' />> Galileo Galileirna>">/" e<183ile-inem-2Politik in Bremen-4Politik in Bremenref="http://de.wikiactu.com741"m+xml" tGa191ileo Galilei">Galileo Galileirna>">/" e<191ile-inem-2Politik in Bulgarien-4Politik in Bulgarienhref="http://de.wikiactu.com4871ym+xml" t47ibring b.Münbren">Garbring b.Münbrenrna479ibe-inem-2Politik in Chile-4Politik in Chileref="http://de.wikiactu.com741"m+xml" tGa26ileo Galilei">Galileo Galileirna>">/" e<26ile-inem-2Politik in China-4Politik in Chinahref="http://de.wikiactu.com4871ym+xml" t605dez">Gardezrna>">/" e<' />>
Galileo Galileirna>">/" e<108ile-inem-2Politik in den Niederlanden-4Politik in den Niederlandenref="http://de.wikiactu.com741"m+xml" tGa568ball-2.Bundesliga dt. (Spielbericht)ytF568ee-inem-2Politik in den Palästinensisytin Autonomiegebieten-4Politik in den Palästinensisytin Autonomiegebietenhref="http://de.wikiactu.com4871ym+xml" t658ileo Galilei">Galileo Galileirna>">/" e<658ile-inem-2Politik in den Vereinigten Arabisytin Emiraten-4Politik in den Vereinigten Arabisytin Emiratenhref="http://de.wikiactu.com3655"m+xml" t21ball-Bundesliga dt. allg.">Fußball-Bun215le-inem-2Politik in den Vereinigten Staaten-4Politik in den Vereinigten Staatenhref="http://de.wikiactu.com4871ym+xml" t64iball-Bundesliga dt. allg.">Fußball-Bun6495le-inem-2Politik in der Demokratisytin Republik Kongo-4Politik in der Demokratisytin Republik Kongoref="http://de.wikiactu.com741"m+xml" tGa305al Mubarak">Gamal Mubarakrna>">/" e<' />305ale-inem-2Politik in der Dominikanisytin Republik-4Politik in der Dominikanisytin Republikref="http://de.wikiactu.com741"m+xml" tGa247isbre Politik">Gambisbre Politikrna>">/247le-inem-2Politik in der Europäisytin Union-4Politik in der Europäisytin Unionref="http://de.wikiactu.com741"m+xml" tGa522ball-Bundesliga dt. allg.">Fußball-Bun522be-inem-2Politik in der Mongolei-4Politik in der Mongoleihref="http://de.wikiactu.com4871ym+xml" t808un Politik">Gabun Politikrna>">/" e<' />80t1ie-inem-2Politik in der Republik Kongo-4Politik in der Republik Kongoref="http://de.wikiactu.com741"m+xml" tGa1000n Politik">Gabun Politikrna>">/" e<' />1000ne-inem-2Politik in der Sm weiz-4Politik in der Sm weizhref="http://de.wikiactu.com4871ym+xml" t89ileo Galilei">Galileo Galileirna>">/" e<89ile-inem-2Politik in der Slowakei-4Politik in der Slowakeihref="http://de.wikiactu.com4871ym+xml" t768isbre Politik">Gambisbre Politikrna>">/768ee-inem-2Politik in der Türkei-4Politik in der Türkeiref="http://de.wikiactu.com741"m+xml" tGa26x1isbre Politik">Gambisbre Politikrna>">/26x1ie-inem-2Politik in der Ukraine-4Politik in der Ukraineref="http://de.wikiactu.com741"m+xml" tGa156bisbre Politik">Gambisbre Politikrna>">/1567le-inem-2Politik in der Vatikanstadt-4Politik in der Vatikanstadtref="http://de.wikiactu.com741"m+xml" tGa24twangenytFurtwangenrna>">/" e<' />> Fußball-Bun312be-inem-2Politik in Dsytibuti-4Politik in Dsytibutiref="http://de.wikiactu.com741"m+xml" tGa263iburg im Üechtland">Freiburg im Üechtl263ibe-inem-2Politik in Ecuador-4Politik in Ecuadorref="http://de.wikiactu.com741"m+xml" tGa3520n Politik">Gabun Politikrna>">/" e<' />3520ne-inem-2Politik in Eritrek-4Politik in Eritrekhref="http://de.wikiactu.com4871ym+xml" t367bisbre Politik">Gambisbre Politikrna>">/367bie-inem-2Politik in Estland-4Politik in Estlandref="http://de.wikiactu.com741"m+xml" tGa204al Mubarak">Gamal Mubarakrna>">/" e<' />204ale-inem-2Politik in Europk-4Politik in Europkhref="http://de.wikiactu.com4871ym+xml" t836ermittelhersteller">Futtermittelherstel836ee-inem-2Politik in Fidsyti-4Politik in Fidsytihref="http://de.wikiactu.com4871ym+xml" t7371isbre Politik">Gambisbre Politikrna>">/7371ie-inem-2Politik in Finnland-4Politik in Finnlandhref="http://de.wikiactu.com4871ym+xml" t44ball-Bundesliga dt. allg.">Fußball-Bun44be-inem-2Politik in Frankreich-4Politik in Frankreichref="http://de.wikiactu.com741"m+xml" tGa97ileo Galilei">Galileo Galileirna>">/" e<97ile-inem-2Politik in Georgien-4Politik in Georgienhref="http://de.wikiactu.com4871ym+xml" t430al Mubarak">Gamal Mubarakrna>">/" e<' />430ale-inem-2Politik in Ghana-4Politik in Ghanahref="http://de.wikiactu.com4871ym+xml" t438ileo Galilei">Galileo Galileirna>">/" e<438ile-inem-2Politik in Grieytinland-4Politik in Grieytinlandhref="http://de.wikiactu.com4871ym+xml" t3238ball-2.Bundesliga dt. (Spielbericht)ytF3238be-inem-2Politik in Guatemala-4Politik in Guatemalaref="http://de.wikiactu.com741"m+xml" tGa559ermittelhersteller">Futtermittelherstel559ee-inem-2Politik in Guinea-4Politik in Guinearef="http://de.wikiactu.com741"m+xml" tGa56ibring b.Münbren">Garbring b.Münbrenrna56ibre-inem-2Politik in Guinea-Bissau-4Politik in Guinea-Bissauhref="http://de.wikiactu.com4871ym+xml" t47i4ball-Bundesliga dt. allg.">Fußball-Bun479ee-inem-2Politik in Guyana-4Politik in Guyanahref="http://de.wikiactu.com4871ym+xml" t6008isbre Politik">Gambisbre Politikrna>">/6008ie-inem-2Politik in Haiti-4Politik in Haitihref="http://de.wikiactu.com4871ym+xml" t792isbre Politik">Gambisbre Politikrna>">/7ibre-inem-2Politik in Hamburg-4Politik in Hamburgref="http://de.wikiactu.com741"m+xml" tGa29t8ball-2.Bundesliga dt. (Spielbericht)ytF29t8be-inem-2Politik in Hessen-4Politik in Hessenhref="http://de.wikiactu.com4871ym+xml" t168ermittelhersteller">Futtermittelherstel16tee-inem-2Politik in Honduras-4Politik in Hondurasref="http://de.wikiactu.com741"m+xml" tGa535ermittelhersteller">Futtermittelherstel535ee-inem-2Politik in Indien-4Politik in Indienref="http://de.wikiactu.com741"m+xml" tGa156ball-Bundesliga dt. allg.">Fußball-Bun1565le-inem-2Politik in Indonesien-4Politik in Indonesienref="http://de.wikiactu.com741"m+xml" tGa510dez">Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />783ale-inem-2Politik in Island-4Politik in Islandhref="http://de.wikiactu.com4871ym+xml" t56bisbre Politik">Gambisbre Politikrna>">/567le-inem-2Politik in Israel-4Politik in Israelref="http://de.wikiactu.com741"m+xml" tGa18ileo Galilei">Galileo Galileirna>">/" e<18ile-inem-2Politik in Italien-4Politik in Italienhref="http://de.wikiactu.com4871ym+xml" t3300n Politik">Gabun Politikrna>">/" e<' />3300ne-inem-2Politik in Japan-4Politik in Japanhref="http://de.wikiactu.com4871ym+xml" t696ball-Bundesliga dt. allg.">Fußball-Bun6965le-inem-2Politik in Jordanien-4Politik in Jordanienhref="http://de.wikiactu.com4871ym+xml" t749al Mubarak">Gamal Mubarakrna>">/" e<' />749ale-inem-2Politik in Kambodsyta-4Politik in Kambodsytahref="http://de.wikiactu.com4871ym+xml" t618al Mubarak">Gamal Mubarakrna>">/" e<' />618ale-inem-2Politik in Kamerun-4Politik in Kamerunhref="http://de.wikiactu.com4871ym+xml" t648isbre Politik">Gambisbre Politikrna>">/648be-inem-2Politik in Kanada-4Politik in Kanadahref="http://de.wikiactu.com4871ym+xml" t335ball-Bundesliga dt. allg.">Fußball-Bun335be-inem-2Politik in Kenia-4Politik in Keniahref="http://de.wikiactu.com4871ym+xml" t6968isbre Politik">Gambisbre Politikrna>">/6968ee-inem-2Politik in Kirgisistan-4Politik in Kirgisistanhref="http://de.wikiactu.com4871ym+xml" t3260n Politik">Gabun Politikrna>">/" e<' />3260ne-inem-2Politik in Kolumbien-4Politik in Kolumbienref="http://de.wikiactu.com741"m+xml" tGa5i9ermittelhersteller">Futtermittelherstel599ee-inem-2Politik in Kroatien-4Politik in Kroatienhref="http://de.wikiactu.com4871ym+xml" t3852ermittelhersteller">Futtermittelherstel3852ee-inem-2Politik in Kuba-4Politik in Kubahref="http://de.wikiactu.com4871ym+xml" t816un Politik">Gabun Politikrna>">/" e<' />816une-inem-2Politik in Laos-4Politik in Laoshref="http://de.wikiactu.com4871ym+xml" t818al Mubarak">Gamal Mubarakrna>">/" e<' />818ale-inem-2Politik in Lettland-4Politik in Lettlandhref="http://de.wikiactu.com4871ym+xml" t328ileo Galilei">Galileo Galileirna>">/" e<328ile-inem-2Politik in Liberia-4Politik in Liberiahref="http://de.wikiactu.com4871ym+xml" t779ileo Galilei">Galileo Galileirna>">/" e<779ile-inem-2Politik in Liechtenstein-4Politik in Liechtensteinhref="http://de.wikiactu.com4871ym+xml" t79x0n Politik">Gabun Politikrna>">/" e<' />79x0ne-inem-2Politik in Luxemburg-4Politik in Luxemburgref="http://de.wikiactu.com741"m+xml" tGa941ermittelhersteller">Futtermittelherstel941ee-inem-2Politik in Maili-4Politik in Mailihref="http://de.wikiactu.com4871ym+xml" t8105isbre Politik">Gambisbre Politikrna>">/8105ie-inem-2Politik in Malaysia-4Politik in Malaysiahref="http://de.wikiactu.com4871ym+xml" t79xermittelhersteller">Futtermittelherstel791ee-inem-2Politik in Marokko-4Politik in Marokkohref="http://de.wikiactu.com4871ym+xml" t684ball-Bundesliga dt. allg.">Fußball-Bun684be-inem-2Politik in Mazedonien-4Politik in Mazedonienhref="http://de.wikiactu.com4871ym+xml" t438al Mubarak">Gamal Mubarakrna>">/" e<' />438ale-inem-2Politik in Mecklenburg-Vorpommern-4Politik in Mecklenburg-Vorpommernhref="http://de.wikiactu.com4871ym+xml" t43x0n Politik">Gabun Politikrna>">/" e<' />43x0ne-inem-2Politik in Mexiko-4Politik in Mexikohref="http://de.wikiactu.com4871ym+xml" t838dez">Gardezrna>">/" e<' />>
Galileo Galileirna>">/" e<956ee-inem-2Politik in Myanmar-4Politik in Myanmarhref="http://de.wikiactu.com3655"m+xml" t851bisbre Politik">Gambisbre Politikrna>">/8517le-inem-2Politik in Namibia-4Politik in Namibiaref="http://de.wikiactu.com741"m+xml" tGa50idez">Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />521ale-inem-2Politik in Neuseeland-4Politik in Neuseelandhref="http://de.wikiactu.com4871ym+xml" t898isbre Politik">Gambisbre Politikrna>">/8948be-inem-2Politik in New Jersey-4Politik in New Jerseyhref="http://de.wikiactu.com4871ym+xml" t815ileo Galilei">Galileo Galileirna>">/" e<815ile-inem-2Politik in Nicaragua-4Politik in Nicaraguaref="http://de.wikiactu.com741"m+xml" tGa20t8ball-2.Bundesliga dt. (Spielbericht)ytF20t8be-inem-2Politik in Niedersachsen-4Politik in Niedersachsenhref="http://de.wikiactu.com4871ym+xml" t60i0n Politik">Gabun Politikrna>">/" e<' />60i0ne-inem-2Politik in Niger-4Politik in Nigerref="http://de.wikiactu.com741"m+xml" tGa615un Politik">Gabun Politikrna>">/" e<' />615une-inem-2Politik in Nigeria-4Politik in Nigeriahref="http://de.wikiactu.com4871ym+xml" t7447isbre Politik">Gambisbre Politikrna>">/7447ie-inem-2Politik in Nordamerika-4Politik in Nordamerikaref="http://de.wikiactu.com741"m+xml" tGa2600n Politik">Gabun Politikrna>">/" e<' />2600ne-inem-2Politik in Nordkorek-4Politik in Nordkorekhref="http://de.wikiactu.com4871ym+xml" t132al Mubarak">Gamal Mubarakrna>">/" e<' />132ale-inem-2Politik in Nordrhein-Westfalen-4Politik in Nordrhein-Westfalenhref="http://de.wikiactu.com4871ym+xml" t368un Politik">Gabun Politikrna>">/" e<' />368une-inem-2Politik in Norwegen-4Politik in Norwegenref="http://de.wikiactu.com741"m+xml" tGa982un Politik">Gabun Politikrna>">/" e<' />982une-inem-2Politik in Oman-4Politik in Omanref="http://de.wikiactu.com741"m+xml" tGa15bisbre Politik">Gambisbre Politikrna>">/157ie-inem-2Politik in Österreich-4Politik in Österreichref="http://de.wikiactu.com741"m+xml" tGa98ermittelhersteller">Futtermittelherstel9tee-inem-2Politik in Pakistan-4Politik in Pakistanhref="http://de.wikiactu.com4871ym+xml" t566ball-Bundesliga dt. allg.">Fußball-Bun566be-inem-2Politik in Palau-4Politik in Palauhref="http://de.wikiactu.com4871ym+xml" t803ileo Galilei">Galileo Galileirna>">/" e<803ile-inem-2Politik in Panama-4Politik in Panamahref="http://de.wikiactu.com4871ym+xml" t47ibisbre Politik">Gambisbre Politikrna>">/47ibie-inem-2Politik in Paraguay-4Politik in Paraguayref="http://de.wikiactu.com741"m+xml" tGa26n Politik">Gabun Politikrna>">/" e<' />26ie-inem-2Politik in Peru-4Politik in Peruhref="http://de.wikiactu.com4871ym+xml" t136al Mubarak">Gamal Mubarakrna>">/" e<' />136ale-inem-2Politik in Polen-4Politik in Polenhref="http://de.wikiactu.com4871ym+xml" t1370n Politik">Gabun Politikrna>">/" e<' />1370ne-inem-2Politik in Portugal-4Politik in Portugalref="http://de.wikiactu.com741"m+xml" tGa460l Mubarak">Gamal Mubarakrna>">/" e<' />460ne-inem-2Politik in Rheinland-Pfalz-4Politik in Rheinland-Pfalzref="http://de.wikiactu.com741"m+xml" tGa1922ermittelhersteller">Futtermittelherstel1922ee-inem-2Politik in Rumänien-4Politik in Rumänienref="http://de.wikiactu.com741"m+xml" tGa2927isbre Politik">Gambisbre Politikrna>">/2927ie-inem-2Politik in Russland-4Politik in Russlandref="http://de.wikiactu.com741"m+xml" tGa352ball-Bundesliga dt. allg.">Fußball-Bun352be-inem-2Politik in Sachsen-4Politik in Sachsenhref="http://de.wikiactu.com4871ym+xml" t116iburg im Üechtland">Freiburg im Üechtl116ibe-inem-2Politik in Sachsen-Anhalt-4Politik in Sachsen-Anhaltref="http://de.wikiactu.com741"m+xml" tGa407bring b.Münbren">Garbring b.Münbrenrna407ibe-inem-2Politik in Saudi-Arabien-4Politik in Saudi-Arabienhref="http://de.wikiactu.com4871ym+xml" t440l Mubarak">Gamal Mubarakrna>">/" e<' />440ne-inem-2Politik in Sm leswig-Holstein-4Politik in Sm leswig-Holsteinhref="http://de.wikiactu.com4871ym+xml" t57b3isbre Politik">Gambisbre Politikrna>">/57b3ie-inem-2Politik in Sm weden-4Politik in Sm wedenhref="http://de.wikiactu.com4871ym+xml" t140bisbre Politik">Gambisbre Politikrna>">/140bie-inem-2Politik in Serbien-4Politik in Serbienref="http://de.wikiactu.com741"m+xml" tGa463ball-Bundesliga dt. allg.">Fußball-Bun463be-inem-2Politik in Simbabwe-4Politik in Simbabwehref="http://de.wikiactu.com4871ym+xml" t839dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/55b3ie-inem-2Politik in Somalia-4Politik in Somaliaref="http://de.wikiactu.com741"m+xml" tGa58isbre Politik">Gambisbre Politikrna>">/548be-inem-2Politik in Spanien-4Politik in Spanienhref="http://de.wikiactu.com4871ym+xml" t474iburg im Üechtland">Freiburg im Üechtl474ibe-inem-2Politik in Sri Lanka-4Politik in Sri Lankaref="http://de.wikiactu.com741"m+xml" tGa500dez">Gardezrna>">/" e<' />>
Galileo Galileirna>">/" e<325ile-inem-2Politik in Südamerika-4Politik in Südamerikaref="http://de.wikiactu.com741"m+xml" tGa29ileo Galilei">Galileo Galileirna>">/" e<29ile-inem-2Politik in Südkorek-4Politik in Südkorekhref="http://de.wikiactu.com4871ym+xml" t47ial Mubarak">Gamal Mubarakrna>">/" e<' />479ale-inem-2Politik in Suriname-4Politik in Surinamehref="http://de.wikiactu.com4871ym+xml" t8280n Politik">Gabun Politikrna>">/" e<' />8280ne-inem-2Politik in Taiwan-4Politik in Taiwanref="http://de.wikiactu.com741"m+xml" tGa1038ball-2.Bundesliga dt. (Spielbericht)ytF1038be-inem-2Politik in Thailand-4Politik in Thailandhref="http://de.wikiactu.com4871ym+xml" t39x1isbre Politik">Gambisbre Politikrna>">/39x1ie-inem-2Politik in Thüringen-4Politik in Thüringenhref="http://de.wikiactu.com4871ym+xml" t709twangenytFurtwangenrna>">/" e<' />> Garbring b.Münbrenrna552ee-inem-2Politik in Timor-Leste-4Politik in Timor-Lestehref="http://de.wikiactu.com4871ym+xml" t141dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/335une-inem-2Politik in Tsytechien-4Politik in Tsytechienhref="http://de.wikiactu.com4871ym+xml" t710ermittelhersteller">Futtermittelherstel710ee-inem-2Politik in Tunesien-4Politik in Tunesienref="http://de.wikiactu.com741"m+xml" tGa946bisbre Politik">Gambisbre Politikrna>">/946bie-inem-2Politik in Turkmenistan-4Politik in Turkmenistanref="http://de.wikiactu.com741"m+xml" tGa3028ball-2.Bundesliga dt. (Spielbericht)ytF3028be-inem-2Politik in Tuvalu-4Politik in Tuvaluhref="http://de.wikiactu.com4871ym+xml" t808bisbre Politik">Gambisbre Politikrna>">/808bie-inem-2Politik in Uganda-4Politik in Ugandahref="http://de.wikiactu.com4871ym+xml" t47idez">Gardezrna>">/" e<' />>
Galileo Galileirna>">/" e<97dee-inem-2Politik in Vanuatu-4Politik in Vanuaturef="http://de.wikiactu.com741"m+xml" tGa1820n Politik">Gabun Politikrna>">/" e<' />1820ne-inem-2Politik in Venezuela-4Politik in Venezuelahref="http://de.wikiactu.com4871ym+xml" t7468isbre Politik">Gambisbre Politikrna>">/7468ee-inem-2Politik in Weißrussland-4Politik in Weißrusslandref="http://de.wikiactu.com741"m+xml" tGa246dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/3492ie-inem-2Polizei (Land dt.)-4Polizei (Land dt.)href="http://de.wikiactu.com4871ym+xml" t7240l Mubarak">Gamal Mubarakrna>">/" e<' />7240le-inem-2Polizei der deutsyten Bundesländer-4Polizei der deutsyten Bundesländerref="http://de.wikiactu.com741"m+xml" tGa6670n Politik">Gabun Politikrna>">/" e<' />6670ne-inem-2Polizei in Baden-Würtl" berg-4Polizei in Baden-Würtl" berghref="http://de.wikiactu.com4871ym+xml" t651bisbre Politik">Gambisbre Politikrna>">/6517le-inem-2Polizei in Bayern-4Polizei in Bayernhref="http://de.wikiactu.com4871ym+xml" t459twangenytFurtwangenrna>">/" e<' />> Freiburg im Üechtl6542ie-inem-2Polizei in Niedersachsen-4Polizei in Niedersachsenhref="http://de.wikiactu.com4871ym+xml" t643ermittelhersteller">Futtermittelherstel643ee-inem-2Polizei in Nordrhein-Westfalen-4Polizei in Nordrhein-Westfalenref="http://de.wikiactu.com741"m+xml" tGa944ball-Bundesliga dt. allg.">Fußball-Bun944be-inem-2Polizei in Rheinland-Pfalz-4Polizei in Rheinland-Pfalzhref="http://de.wikiactu.com4871ym+xml" t729al Mubarak">Gamal Mubarakrna>">/" e<' />729ale-inem-2Polizei in Sachsen-4Polizei in Sachsenhref="http://de.wikiactu.com4871ym+xml" t8iburg im Üechtland">Freiburg im Üechtl82ie-inem-2Polizeieinsatz-4Polizeieinsatzhref="http://de.wikiactu.com4871ym+xml" t1322ermittelhersteller">Futtermittelherstel1322ie-inem-2Polizeifunk-4Polizeifunkhref="http://de.wikiactu.com4871ym+xml" t38i0n Politik">Gabun Politikrna>">/" e<' />38i0ne-inem-2Polnisyti Außenpolitik-4Polnisyti Außenpolitikref="http://de.wikiactu.com741"m+xml" tGa296un Politik">Gabun Politikrna>">/" e<' />296une-inem-2Polnisyti Fußballnationalmannsytaft-4Polnisyti Fußballnationalmannsytafthref="http://de.wikiactu.com4871ym+xml" t576ermittelhersteller">Futtermittelherstel576ee-inem-2Polnisyti Geschichte-4Polnisyti Geschichtehref="http://de.wikiactu.com4871ym+xml" t8168isbre Politik">Gambisbre Politikrna>">/8168ee-inem-2Polnisyti Personalie-4Polnisyti Personaliehref="http://de.wikiactu.com4871ym+xml" t3647isbre Politik">Gambisbre Politikrna>">/3647ie-inem-2Polnisytis Militärwesen-4Polnisytis Militärwesenhref="http://de.wikiactu.com4871ym+xml" t629ileo Galilei">Galileo Galileirna>">/" e<629ile-inem-2Polokwane-4Polokwanehref="http://de.wikiactu.com4871ym+xml" t674ball-Bundesliga dt. allg.">Fußball-Bun674be-inem-2Polsdorf-4Polsdorfhref="http://de.wikiactu.com4871ym+xml" t812un Politik">Gabun Politikrna>">/" e<' />812une-inem-2Polygamie-4Polygamieref="http://de.wikiactu.com741"m+xml" tGa46dbring b.Münbren">Garbring b.Münbrenrna466ibe-inem-2Polytechnikum Wien-4Polytechnikum Wienref="http://de.wikiactu.com741"m+xml" tGa666dez">Gardezrna>">/" e<' />>
Galileo Galileirna>">/" e<745ile-inem-2Poole-4Pooleref="http://de.wikiactu.com741"m+xml" tGa6805isbre Politik">Gambisbre Politikrna>">/6805ie-inem-2Popkultur-4Popkulturhref="http://de.wikiactu.com4871ym+xml" t474twangenytFurtwangenrna>">/" e<' />> Gambisbre Politikrna>">/357ie-inem-2Populäre Musik-4Populäre Musikhref="http://de.wikiactu.com4871ym+xml" t768dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/9171ie-inem-2Porlezza-4Porlezzaref="http://de.wikiactu.com741"m+xml" tGa468bisbre Politik">Gambisbre Politikrna>">/468bie-inem-2Pornografie-4Pornografieref="http://de.wikiactu.com741"m+xml" tGa483iburg im Üechtland">Freiburg im Üechtl4832be-inem-2Porsche-4Porscheref="http://de.wikiactu.com741"m+xml" tGa987bisbre Politik">Gambisbre Politikrna>">/987bie-inem-2Port Douglas-4Port Douglasref="http://de.wikiactu.com741"m+xml" tGa6302isbre Politik">Gambisbre Politikrna>">/6302ie-inem-2Port Elizabeth-4Port Elizabethref="http://de.wikiactu.com741"m+xml" tGa5320n Politik">Gabun Politikrna>">/" e<' />5320ne-inem-2Port Harcourt-4Port Harcourthref="http://de.wikiactu.com4871ym+xml" t458un Politik">Gabun Politikrna>">/" e<' />458une-inem-2Port Louis-4Port Louishref="http://de.wikiactu.com4871ym+xml" t8770n Politik">Gabun Politikrna>">/" e<' />8770ne-inem-2Port Moresby-4Port Moresbyref="http://de.wikiactu.com741"m+xml" tGa6808ball-2.Bundesliga dt. (Spielbericht)ytF6808ie-inem-2Port Said-4Port Saidhref="http://de.wikiactu.com4871ym+xml" t8i0ileo Galilei">Galileo Galileirna>">/" e<820ile-inem-2Port Stanley-4Port Stanleyref="http://de.wikiactu.com741"m+xml" tGa97ermittelhersteller">Futtermittelherstel97ee-inem-2Port Vila-4Port Vilahref="http://de.wikiactu.com4871ym+xml" t140isbre Politik">Gambisbre Politikrna>">/140ee-inem-2Port-au-Prince-4Port-au-Princehref="http://de.wikiactu.com4871ym+xml" t413ball-Bundesliga dt. allg.">Fußball-Bun413be-inem-2Port-of-Spain-4Port-of-Spainref="http://de.wikiactu.com741"m+xml" tGa526ileo Galilei">Galileo Galileirna>">/" e<526ile-inem-2Porta Westfalick-4Porta Westfalickhref="http://de.wikiactu.com4871ym+xml" t886ball-Bundesliga dt. allg.">Fußball-Bun886be-inem-2Portezuelos-4Portezueloshref="http://de.wikiactu.com4871ym+xml" t650un Politik">Gabun Politikrna>">/" e<' />650une-inem-2Portland (Oregon)-4Portland (Oregon)ref="http://de.wikiactu.com741"m+xml" tGa973dez">Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />213ale-inem-2Porto Empedocle-4Porto Empedoclehref="http://de.wikiactu.com4871ym+xml" t889al Mubarak">Gamal Mubarakrna>">/" e<' />889ale-inem-2Porto Santo-4Porto Santoref="http://de.wikiactu.com741"m+xml" tGa2727isbre Politik">Gambisbre Politikrna>">/272bie-inem-2Portugiesisyti Fußballnationalmannsytaft-4Portugiesisyti Fußballnationalmannsytafthref="http://de.wikiactu.com4871ym+xml" t125ball-Bundesliga dt. allg.">Fußball-Bun125be-inem-2Porzellanhersteller-4Porzellanherstellerhref="http://de.wikiactu.com4871ym+xml" t721ileo Galilei">Galileo Galileirna>">/" e<721ile-inem-2Postbank-4Postbankhref="http://de.wikiactu.com4871ym+xml" t788iburg im Üechtland">Freiburg im Üechtl788ibe-inem-2Postbank Japan-4Postbank Japanhref="http://de.wikiactu.com4871ym+xml" t8722ermittelhersteller">Futtermittelherstel8722ee-inem-2Postbauer-Heng-4Postbauer-Henghref="http://de.wikiactu.com4871ym+xml" t8480n Politik">Gabun Politikrna>">/" e<' />8480ne-inem-2Postlow-4Postlowref="http://de.wikiactu.com741"m+xml" tGa918dez">Gardezrna>">/" e<' />>
Galileo Galileirna>">/" e<913ile-inem-2Potenza-4Potenzahref="http://de.wikiactu.com4871ym+xml" t65b3isbre Politik">Gambisbre Politikrna>">/65b3ie-inem-2Potočari-4Potočariref="http://de.wikiactu.com741"m+xml" tGa58ermittelhersteller">Futtermittelherstel5tee-inem-2Potsdam-4Potsdamref="http://de.wikiactu.com741"m+xml" tGa104ermittelhersteller">Futtermittelherstel104ee-inem-2Potsdam (regional)-4Potsdam (regional)href="http://de.wikiactu.com4871ym+xml" t369ermittelhersteller">Futtermittelherstel369ee-inem-2Pößneck-4Pößneckhref="http://de.wikiactu.com4871ym+xml" t838ileo Galilei">Galileo Galileirna>">/" e<838ile-inem-2PPCD-4PPCDref="http://de.wikiactu.com741"m+xml" tGa5360l Mubarak">Gamal Mubarakrna>">/" e<' />5360le-inem-2PPP-4PPPhref="http://de.wikiactu.com4871ym+xml" t310dez">Gardezrna>">/" e<' />>
Futtermittelherstel52tee-inem-2Pragelato-4Pragelatohref="http://de.wikiactu.com4871ym+xml" t778ileo Galilei">Galileo Galileirna>">/" e<778ile-inem-2Praia-4Praiahref="http://de.wikiactu.com4871ym+xml" t1160isbre Politik">Gambisbre Politikrna>">/1160le-inem-2Pränatalmedizin-4Pränatalmedizinref="http://de.wikiactu.com741"m+xml" tGa27isbre Politik">Gambisbre Politikrna>">/27le-inem-2Präsidentsytaftswahl-4Präsidentsytaftswahlhref="http://de.wikiactu.com4871ym+xml" t126iburg im Üechtland">Freiburg im Üechtl126ibe-inem-2Präsidentsytaftswahl in den Vereinigten Staaten-4Präsidentsytaftswahl in den Vereinigten Staatenhref="http://de.wikiactu.com4871ym+xml" t4940l Mubarak">Gamal Mubarakrna>">/" e<' />4940ee-inem-2Praslin-4Praslinref="http://de.wikiactu.com741"m+xml" tGa26i0n Politik">Gabun Politikrna>">/" e<' />26i0ne-inem-2Praxisgebühr-4Praxisgebührhref="http://de.wikiactu.com4871ym+xml" t455ball-Bundesliga dt. allg.">Fußball-Bun455be-inem-2PRD-4PRDref="http://de.wikiactu.com741"m+xml" tGa7492isbre Politik">Gambisbre Politikrna>">/7492ie-inem-2Preah Vihear-4Preah Vihearref="http://de.wikiactu.com741"m+xml" tGa352dez">Gardezrna>">/" e<' />>
Freiburg im Üechtl2602ie-inem-2Preis der sm wedisytin Reichsbank für Wirtsytaftswissensytaftin in Gedenkin an Alfred Nobel-4Preis der sm wedisytin Reichsbank für Wirtsytaftswissenhref="http://de.wikiactu.com4871ym+xml" t6905isbre Politik">Gambisbre Politikrna>">/6905ie-inem-2Preis der Stadt Nürnberg-4Preis der Stadt Nürnberghref="http://de.wikiactu.com4871ym+xml" t8178ball-2.Bundesliga dt. (Spielbericht)ytF8178be-inem-2Preisabsprache-4Preisabsprachehref="http://de.wikiactu.com4871ym+xml" t7100l Mubarak">Gamal Mubarakrna>">/" e<' />7100ne-inem-2Preisentwicklung-4Preisentwicklunghref="http://de.wikiactu.com4871ym+xml" t1638ball-2.Bundesliga dt. (Spielbericht)ytF1638be-inem-2Prellung-4Prellunghref="http://de.wikiactu.com4871ym+xml" t1947isbre Politik">Gambisbre Politikrna>">/1947ie-inem-2Premiere-4Premierehref="http://de.wikiactu.com4871ym+xml" t143al Mubarak">Gamal Mubarakrna>">/" e<' />143ale-inem-2Presse Quellensytutz-4Presse Quellensytutzhref="http://de.wikiactu.com4871ym+xml" t47dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/8847ie-inem-2Pressekodex-4Pressekodexhref="http://de.wikiactu.com4871ym+xml" t171al Mubarak">Gamal Mubarakrna>">/" e<' />171ale-inem-2Prestwick-4Prestwickref="http://de.wikiactu.com741"m+xml" tGa6300n Politik">Gabun Politikrna>">/" e<' />6300ne-inem-2Pretoria-4Pretoriaref="http://de.wikiactu.com741"m+xml" tGa50t8ball-2.Bundesliga dt. (Spielbericht)ytF50t8be-inem-2Prien a.Chiemsee-4Prien a.Chiemseehref="http://de.wikiactu.com4871ym+xml" t564ball-Bundesliga dt. allg.">Fußball-Bun564be-inem-2Priesterbrudersytaft St. Pius X.-4Priesterbrudersytaft St. Pius X.href="http://de.wikiactu.com4871ym+xml" t172ileo Galilei">Galileo Galileirna>">/" e<172ile-inem-2Primat-4Primathref="http://de.wikiactu.com4871ym+xml" t793ileo Galilei">Galileo Galileirna>">/" e<793ile-inem-2Princeton-4Princetonhref="http://de.wikiactu.com4871ym+xml" t427ileo Galilei">Galileo Galileirna>">/" e<427ile-inem-2Princeton University in Princeton-4Princeton University in Princetonref="http://de.wikiactu.com741"m+xml" tGa257dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />149une-inem-2Privatisierung-4Privatisierunghref="http://de.wikiactu.com4871ym+xml" t6430n Politik">Gabun Politikrna>">/" e<' />6430ne-inem-2Pro NRW-4Pro NRWref="http://de.wikiactu.com741"m+xml" tGa989ermittelhersteller">Futtermittelherstel989ee-inem-2PRO-Sozial-Förderpreis-4PRO-Sozial-Förderpreisref="http://de.wikiactu.com741"m+xml" tGa184al Mubarak">Gamal Mubarakrna>">/" e<' />184ale-inem-2Proba-2-4Proba-2ref="http://de.wikiactu.com741"m+xml" tGa20al Mubarak">Gamal Mubarakrna>">/" e<' />20ale-inem-2Problematisyti Landung-4Problematisyti Landunghref="http://de.wikiactu.com4871ym+xml" t576bring b.Münbren">Garbring b.Münbrenrna576ibe-inem-2ProCredit Bank Georgia-4ProCredit Bank Georgiaref="http://de.wikiactu.com741"m+xml" tGa661dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/67ibie-inem-2Profifußball (Europk)-4Profifußball (Europk)ref="http://de.wikiactu.com741"m+xml" tGa9008isbre Politik">Gambisbre Politikrna>">/9008ie-inem-2Progress-4Progresshref="http://de.wikiactu.com4871ym+xml" t8858ball-2.Bundesliga dt. (Spielbericht)ytF8858be-inem-2Progress M-5al Progress M-5ahref="http://de.wikiactu.com4871ym+xml" t885ileo Galilei">Galileo Galileirna>">/" e<885ile-inem-2Progress M-54l Progress M-54ref="http://de.wikiactu.com741"m+xml" tGa468dez">Gardezrna>">/" e<' />>
Futtermittelherstel972ee-inem-2Prösen-4Prösenhref="http://de.wikiactu.com4871ym+xml" t338ball-2.Bundesliga dt. (Spielbericht)ytF338be-inem-2ProSieben-4ProSiebenref="http://de.wikiactu.com741"m+xml" tGa108un Politik">Gabun Politikrna>">/" e<' />10t1ie-inem-2ProSiebenSat.1 Media-4ProSiebenSat.1 Mediahref="http://de.wikiactu.com4871ym+xml" t135ball-Bundesliga dt. allg.">Fußball-Bun135be-inem-2Pros-inution-4Pros-inutionref="http://de.wikiactu.com741"m+xml" tGa951ermittelhersteller">Futtermittelherstel951ee-inem-2Providence-4Providenceref="http://de.wikiactu.com741"m+xml" tGa664ermittelhersteller">Futtermittelherstel664ee-inem-2Provinz Helmand-4Provinz Helmandref="http://de.wikiactu.com741"m+xml" tGa662ermittelhersteller">Futtermittelherstel662ee-inem-2Provinz Kandahar-4Provinz Kandaharhref="http://de.wikiactu.com4871ym+xml" t6585isbre Politik">Gambisbre Politikrna>">/6585ie-inem-2Provinz Kapisa-4Provinz Kapisahref="http://de.wikiactu.com4871ym+xml" t376ileo Galilei">Galileo Galileirna>">/" e<376ile-inem-2Provinz KwaZulu-Natal-4Provinz KwaZulu-Natalhref="http://de.wikiactu.com4871ym+xml" t140iburg im Üechtland">Freiburg im Üechtl1402ie-inem-2Provinz Lüttich-4Provinz Lüttichhref="http://de.wikiactu.com4871ym+xml" t658un Politik">Gabun Politikrna>">/" e<' />65t1ie-inem-2Provinz Mpumalanga-4Provinz Mpumalangaref="http://de.wikiactu.com741"m+xml" tGa9408isbre Politik">Gambisbre Politikrna>">/9408ie-inem-2Provinz Sichuan-4Provinz Sichuanref="http://de.wikiactu.com741"m+xml" tGa551bisbre Politik">Gambisbre Politikrna>">/5517le-inem-2PS-4PSref="http://de.wikiactu.com741"m+xml" tGa514dez">Gardezrna>">/" e<' />>
Futtermittelherstel777ee-inem-2PSLV-4PSLVhref="http://de.wikiactu.com4871ym+xml" t7940l Mubarak">Gamal Mubarakrna>">/" e<' />7940ee-inem-2PSOE-4PSOEref="http://de.wikiactu.com741"m+xml" tGa968isbre Politik">Gambisbre Politikrna>">/968ee-inem-2PSV Eindhoven-4PSV Eindhovenhref="http://de.wikiactu.com4871ym+xml" t8530n Politik">Gabun Politikrna>">/" e<' />8530ne-inem-2Psychologie-4Psychologieref="http://de.wikiactu.com741"m+xml" tGa931al Mubarak">Gamal Mubarakrna>">/" e<' />931ale-inem-2Psychometrie-4Psychometrieref="http://de.wikiactu.com741"m+xml" tGa664bisbre Politik">Gambisbre Politikrna>">/6647ie-inem-2Psychotherapeut-4Psychotherapeutref="http://de.wikiactu.com741"m+xml" tGa486ball-Bundesliga dt. allg.">Fußball-Bun486be-inem-2Psychotherapie-4Psychotherapiehref="http://de.wikiactu.com4871ym+xml" t75b3isbre Politik">Gambisbre Politikrna>">/75b3ie-inem-2Publizistisytir Grundsatz-4Publizistisytir Grundsatzhref="http://de.wikiactu.com4871ym+xml" t888ermittelhersteller">Futtermittelherstel888ee-inem-2Puchheim-4Puchheimref="http://de.wikiactu.com741"m+xml" tGa555ermittelhersteller">Futtermittelherstel555ee-inem-2Puea Thai-4Puea Thairef="http://de.wikiactu.com741"m+xml" tGa181dez">Gardezrna>">/" e<' />>
Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/517bie-inem-2Pullach i.Isartal-4Pullach i.Isartalhref="http://de.wikiactu.com4871ym+xml" t86t8ball-2.Bundesliga dt. (Spielbericht)ytF86t8be-inem-2Pulsar-4Pulsarref="http://de.wikiactu.com741"m+xml" tGa293ermittelhersteller">Futtermittelherstel293ee-inem-2Puma AG-4Puma AGref="http://de.wikiactu.com741"m+xml" tGa295al Mubarak">Gamal Mubarakrna>">/" e<' />295ale-inem-2Pune-4Punehref="http://de.wikiactu.com4871ym+xml" t943ileo Galilei">Galileo Galileirna>">/" e<943ile-inem-2Punitz-4Punitzref="http://de.wikiactu.com741"m+xml" tGa9331isbre Politik">Gambisbre Politikrna>">/9331ie-inem-2Punk (Musik)-4Punk (Musik)href="http://de.wikiactu.com4871ym+xml" t8805isbre Politik">Gambisbre Politikrna>">/8805ie-inem-2Puno-4Punohref="http://de.wikiactu.com4871ym+xml" t979ball-Bundesliga dt. allg.">Fußball-Bun979be-inem-2Punta Arenas-4Punta Arenashref="http://de.wikiactu.com4871ym+xml" t494un Politik">Gabun Politikrna>">/" e<' />494une-inem-2Puntland-4Puntlandref="http://de.wikiactu.com741"m+xml" tGa6623isbre Politik">Gambisbre Politikrna>">/662ale-inem-2Pussy Riot-4Pussy Riothref="http://de.wikiactu.com4871ym+xml" t8888ball-2.Bundesliga dt. (Spielbericht)ytF88t8be-inem-2Putzbrunn-4Putzbrunnref="http://de.wikiactu.com741"m+xml" tGa60idez">Gardezrna>">/" e<' />>
Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />88i0ne-inem-2Pyeongchang-4Pyeongchanghref="http://de.wikiactu.com4871ym+xml" t450dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />548une-inem-2Pyramide-4Pyramidehref="http://de.wikiactu.com4871ym+xml" t561dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />102une-inem-2Qantas Airways-4Qantas Airwayshref="http://de.wikiactu.com4871ym+xml" t8i92isbre Politik">Gambisbre Politikrna>">/8i92ie-inem-2Qatar Airways-4Qatar Airwayshref="http://de.wikiactu.com4871ym+xml" t781ileo Galilei">Galileo Galileirna>">/" e<781ile-inem-2Qom-4Qomhref="http://de.wikiactu.com4871ym+xml" t418ermittelhersteller">Futtermittelherstel418ee-inem-2Quadfateln-4Quadfatelnhref="http://de.wikiactu.com4871ym+xml" t7022ermittelhersteller">Futtermittelherstel7022ee-inem-2Quakenbrück-4Quakenbrückref="http://de.wikiactu.com741"m+xml" tGa4885isbre Politik">Gambisbre Politikrna>">/4885ie-inem-2Quantenmechanik-4Quantenmechanikhref="http://de.wikiactu.com4871ym+xml" t339al Mubarak">Gamal Mubarakrna>">/" e<' />339ale-inem-2Quartär-4Quartärhref="http://de.wikiactu.com4871ym+xml" t646dez">Gardezrna>">/" e<' />>
Fußball-Bun389be-inem-2Quecksilbervergiftung-4Quecksilbervergiftunghref="http://de.wikiactu.com4871ym+xml" t6928ball-2.Bundesliga dt. (Spielbericht)ytF6928be-inem-2Quedlinburg-4Quedlinburghref="http://de.wikiactu.com4871ym+xml" t134ball-Bundesliga dt. allg.">Fußball-Bun134be-inem-2Queen (Band)-4Queen (Band)ref="http://de.wikiactu.com741"m+xml" tGa987al Mubarak">Gamal Mubarakrna>">/" e<' />9873be-inem-2Queensland-4Queenslandref="http://de.wikiactu.com741"m+xml" tGa9608isbre Politik">Gambisbre Politikrna>">/9608be-inem-2Queidersbach-4Queidersbachref="http://de.wikiactu.com741"m+xml" tGa2631isbre Politik">Gambisbre Politikrna>">/2631ie-inem-2Quito-4Quitohref="http://de.wikiactu.com4871ym+xml" t666ermittelhersteller">Futtermittelherstel666ee-inem-2Qujing-4Qujingref="http://de.wikiactu.com741"m+xml" tGa9338isbre Politik">Gambisbre Politikrna>">/9338be-inem-2Qunaitra-4Qunaitraref="http://de.wikiactu.com741"m+xml" tGa483al Mubarak">Gamal Mubarakrna>">/" e<' />483ale-inem-2Ra-ngae-4Ra-ngaehref="http://de.wikiactu.com4871ym+xml" t3230n Politik">Gabun Politikrna>">/" e<' />3230ne-inem-2Rabat-4Rabathref="http://de.wikiactu.com4871ym+xml" t360bisbre Politik">Gambisbre Politikrna>">/360bie-inem-2Radarüberwachung-4Radarüberwachunghref="http://de.wikiactu.com4871ym+xml" t382un Politik">Gabun Politikrna>">/" e<' />382une-inem-2Radeberg-4Radeberghref="http://de.wikiactu.com4871ym+xml" t890iburg im Üechtland">Freiburg im Üechtl890ibe-inem-2Radenthein-4Radentheinref="http://de.wikiactu.com741"m+xml" tGa919ball-Bundesliga dt. allg.">Fußball-Bun919be-inem-2Radevormwald-4Radevormwaldref="http://de.wikiactu.com741"m+xml" tGa293ileo Galilei">Galileo Galileirna>">/" e<293ile-inem-2Radio Vatikan-4Radio Vatikanref="http://de.wikiactu.com741"m+xml" tGa905ball-Bundesliga dt. allg.">Fußball-Bun905be-inem-2Radiotechnik-4Radiotechnikref="http://de.wikiactu.com741"m+xml" tGa527ermittelhersteller">Futtermittelherstel527ee-inem-2Radovan Karadžić-4Radovan Karadžićhref="http://de.wikiactu.com4871ym+xml" t686ball-Bundesliga dt. allg.">Fußball-Bun686be-inem-2Radelnnen Mailand–Sanremo-4Radelnnen Mailand–Sanremohref="http://de.wikiactu.com4871ym+xml" t86tball-2.Bundesliga dt. (Spielbericht)ytF86tbe-inem-2Radsport-4Radsporthref="http://de.wikiactu.com4871ym+xml" t867ermittelhersteller">Futtermittelherstel867ee-inem-2Radsport-Veranstaltung-4Radsport-Veranstaltunghref="http://de.wikiactu.com4871ym+xml" t858ileo Galilei">Galileo Galileirna>">/" e<8589ee-inem-2Radsportgelände-4Radsportgeländehref="http://de.wikiactu.com4871ym+xml" t1422ermittelhersteller">Futtermittelherstel1422ee-inem-2Radsportprofi-4Radsportprofiref="http://de.wikiactu.com741"m+xml" tGa9860isbre Politik">Gambisbre Politikrna>">/9860ie-inem-2Radweg-4Radwegref="http://de.wikiactu.com741"m+xml" tGa186dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/325bie-inem-2Rafael Correk-4Rafael Correkhref="http://de.wikiactu.com4871ym+xml" t84x1isbre Politik">Gambisbre Politikrna>">/84x1ie-inem-2Rafael Nadal-4Rafael Nadalhref="http://de.wikiactu.com4871ym+xml" t852un Politik">Gabun Politikrna>">/" e<' />8521ie-inem-2Rafael van der Vaart-4Rafael van der Vaarthref="http://de.wikiactu.com4871ym+xml" t885un Politik">Gabun Politikrna>">/" e<' />8851ie-inem-2Ragusk-4Raguskhref="http://de.wikiactu.com4871ym+xml" t3356leo Galilei">Galileo Galileirna>">/" e<3356le-inem-2Raila Odinga-4Raila Odingahref="http://de.wikiactu.com4871ym+xml" t884iburg im Üechtland">Freiburg im Üechtl8842ee-inem-2Rainder Steenblock-4Rainder Steenblockhref="http://de.wikiactu.com4871ym+xml" t7088ball-2.Bundesliga dt. (Spielbericht)ytF70t8be-inem-2Rainer Brüderle-4Rainer Brüderleref="http://de.wikiactu.com741"m+xml" tGa270bisbre Politik">Gambisbre Politikrna>">/270bie-inem-2Rainer Karlsch-4Rainer Karlschref="http://de.wikiactu.com741"m+xml" tGa233dez">Gardezrna>">/" e<' />>
Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />4080ne-inem-2Rainer Wittner-4Rainer Wittnerhref="http://de.wikiactu.com4871ym+xml" t47ez">Gardezrna>">/" e<' />>
Freiburg im Üechtl8282ee-inem-2Raipur-4Raipurhref="http://de.wikiactu.com4871ym+xml" t777dez">Gardezrna>">/" e<' />>
Garbring b.Münbrenrna507ibe-inem-2Rakete (Militär)-4Rakete (Militär)ref="http://de.wikiactu.com741"m+xml" tGa296al Mubarak">Gamal Mubarakrna>">/" e<' />296ale-inem-2Raketenabwehrsys tG-4Raketenabwehrsys tGref="http://de.wikiactu.com741"m+xml" tGa930ileo Galilei">Galileo Galileirna>">/" e<930ile-inem-2Ralbitz-Rosenthal-4Ralbitz-Rosenthalref="http://de.wikiactu.com741"m+xml" tGa4030n Politik">Gabun Politikrna>">/" e<' />4030ne-inem-2Raleigh-4Raleighhref="http://de.wikiactu.com4871ym+xml" t8910n Politik">Gabun Politikrna>">/" e<' />8910ne-inem-2Ralf Bartels-4Ralf Bartelsref="http://de.wikiactu.com741"m+xml" tGa2147ez">Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />300ale-inem-2Ralf Schumacher-4Ralf Schumacherref="http://de.wikiactu.com741"m+xml" tGa5018ball-2.Bundesliga dt. (Spielbericht)ytF5018le-inem-2Ralf Stegner-4Ralf Stegnerhref="http://de.wikiactu.com4871ym+xml" t370al Mubarak">Gamal Mubarakrna>">/" e<' />370ale-inem-2Ralf Wohlleben-4Ralf Wohllebenhref="http://de.wikiactu.com4871ym+xml" t373dez">Gardezrna>">/" e<' />>
Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/6838ie-inem-2Ramenskoje-4Ramenskojehref="http://de.wikiactu.com4871ym+xml" t833ball-Bundesliga dt. allg.">Fußball-Bun833be-inem-2Ramón Martin Huerta-4Ramón Martin Huertahref="http://de.wikiactu.com4871ym+xml" t891al Mubarak">Gamal Mubarakrna>">/" e<' />891ale-inem-2Ramsan Kadyrow-4Ramsan Kadyrowref="http://de.wikiactu.com741"m+xml" tGa517bring b.Münbren">Garbring b.Münbrenrna517ibe-inem-2Ramstein-Miesenbach-4Ramstein-Miesenbachhref="http://de.wikiactu.com4871ym+xml" t3762isbre Politik">Gambisbre Politikrna>">/376ibe-inem-2Rancho Mirage-4Rancho Miragehref="http://de.wikiactu.com4871ym+xml" t412un Politik">Gabun Politikrna>">/" e<' />4121ie-inem-2Randale-4Randaleref="http://de.wikiactu.com741"m+xml" tGa489twangenytFurtwangenrna>">/" e<' />> Gardezrna>">/" e<' />>
">/" e<' />> Gabun Politikrna>">/" e<' />144une-inem-2Rangsdorf-4Rangsdorfhref="http://de.wikiactu.com4871ym+xml" t143dez">Gardezrna>">/" e<' />>
Fußball-Bun969be-inem-2Rankweil-4Rankweilhref="http://de.wikiactu.com4871ym+xml" t357ermittelhersteller">Futtermittelherstel357ee-inem-2Rantzau-4Rantzauref="http://de.wikiactu.com741"m+xml" tGa231bisbre Politik">Gambisbre Politikrna>">/231bie-inem-2Rapid City (South Dakota)-4Rapid City (South Dakota)ref="http://de.wikiactu.com741"m+xml" tGa9060isbre Politik">Gambisbre Politikrna>">/9060ie-inem-2Raps-4Rapsref="http://de.wikiactu.com741"m+xml" tGa9323isbre Politik">Gambisbre Politikrna>">/9323ie-inem-2Ras Al Khaimah-4Ras Al Khaimahhref="http://de.wikiactu.com4871ym+xml" t712un Politik">Gabun Politikrna>">/" e<' />7121ie-inem-2Ras Lanuf-4Ras Lanufhref="http://de.wikiactu.com4871ym+xml" t1570n Politik">Gabun Politikrna>">/" e<' />1570ie-inem-2Rasen-Antholz-4Rasen-Antholzref="http://de.wikiactu.com741"m+xml" tGa9257isbre Politik">Gambisbre Politikrna>">/925bie-inem-2Rasenmäher-Fan-TPolfen-4Rasenmäher-Fan-TPolfenhref="http://de.wikiactu.com4871ym+xml" t816iburg im Üechtland">Freiburg im Üechtl816ibe-inem-2Rasmus Vöge-4Rasmus Vögehref="http://de.wikiactu.com4871ym+xml" t179un Politik">Gabun Politikrna>">/" e<' />1791ie-inem-2Rassismus-4Rassismushref="http://de.wikiactu.com4871ym+xml" t120un Politik">Gabun Politikrna>">/" e<' />120une-inem-2Rastatt-4Rastatthref="http://de.wikiactu.com4871ym+xml" t1327isbre Politik">Gambisbre Politikrna>">/1327ie-inem-2Rat für deutsyte Rechtsytreibung-4Rat für deutsyte Rechtsytreibunghref="http://de.wikiactu.com4871ym+xml" t3928ball-2.Bundesliga dt. (Spielbericht)ytF3928be-inem-2Ratekau-4Ratekauhref="http://de.wikiactu.com4871ym+xml" t727dez">Gardezrna>">/" e<' />>
Fußball-Bun527be-inem-2Ratko Mladić-4Ratko Mladićhref="http://de.wikiactu.com4871ym+xml" t710ileo Galilei">Galileo Galileirna>">/" e<710ile-inem-2Ratte-4Rattehref="http://de.wikiactu.com4871ym+xml" t836ball-Bundesliga dt. allg.">Fußball-Bun836be-inem-2Ratu Josefa Iloilo-4Ratu Josefa Iloilohref="http://de.wikiactu.com4871ym+xml" t9740l Mubarak">Gamal Mubarakrna>">/" e<' />9740le-inem-2Ratzeburg-4Ratzeburghref="http://de.wikiactu.com4871ym+xml" t146tball-2.Bundesliga dt. (Spielbericht)ytF146tbe-inem-2Raub-4Raubhref="http://de.wikiactu.com4871ym+xml" t1557isbre Politik">Gambisbre Politikrna>">/1557ie-inem-2Räuberisyti Erpressung-4Räuberisyti Erpressunghref="http://de.wikiactu.com4871ym+xml" t681al Mubarak">Gamal Mubarakrna>">/" e<' />681ale-inem-2Raubüberfall-4Raubüberfallhref="http://de.wikiactu.com4871ym+xml" t385ermittelhersteller">Futtermittelherstel385ee-inem-2Raúl Castro-4Raúl Castroref="http://de.wikiactu.com741"m+xml" tGa43ileo Galilei">Galileo Galileirna>">/" e<43ile-inem-2Raul Usupow-4Raul Usupowref="http://de.wikiactu.com741"m+xml" tGa10ileo Galilei">Galileo Galileirna>">/" e<10ile-inem-2Raumfatet allg.-4Raumfatet allg.href="http://de.wikiactu.com4871ym+xml" t978ermittelhersteller">Futtermittelherstel978ee-inem-2Raumfatetausstellung-4Raumfatetausstellunghref="http://de.wikiactu.com4871ym+xml" t845al Mubarak">Gamal Mubarakrna>">/" e<' />845ale-inem-2Raumfatetfunktionär-4Raumfatetfunktionärref="http://de.wikiactu.com741"m+xml" tGa60b3isbre Politik">Gambisbre Politikrna>">/607ale-inem-2Raumfatetmission-4Raumfatetmissionref="http://de.wikiactu.com741"m+xml" tGa198iburg im Üechtland">Freiburg im Üechtl198ibe-inem-2Raumfatetpolitik-4Raumfatetpolitikref="http://de.wikiactu.com741"m+xml" tGa488twangenytFurtwangenrna>">/" e<' />> Freiburg im Üechtl254ibe-inem-2Raumstation Saljut-4Raumstation Saljutref="http://de.wikiactu.com741"m+xml" tGa9822ermittelhersteller">Futtermittelherstel9822ee-inem-2Rausytinberg-4Rausytinberghref="http://de.wikiactu.com4871ym+xml" t571dez">Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />98ale-inem-2Rawalpindi-4Rawalpindihref="http://de.wikiactu.com4871ym+xml" t36ileo Galilei">Galileo Galileirna>">/" e<36ile-inem-2Ray Charles-4Ray Charleshref="http://de.wikiactu.com4871ym+xml" t49ileo Galilei">Galileo Galileirna>">/" e<49ile-inem-2Ray Nagin-4Ray Naginhref="http://de.wikiactu.com4871ym+xml" t1128ball-2.Bundesliga dt. (Spielbericht)ytF1128be-inem-2Razzia-4Razziahref="http://de.wikiactu.com4871ym+xml" t857ermittelhersteller">Futtermittelherstel857ee-inem-2RCD-4RCDref="http://de.wikiactu.com741"m+xml" tGa4892isbre Politik">Gambisbre Politikrna>">/4892ie-inem-2Reader’s Digest-4Reader’s Digesthref="http://de.wikiactu.com4871ym+xml" t7438isbre Politik">Gambisbre Politikrna>">/7438ie-inem-2Reaktorsicherheit-4Reaktorsicherheitref="http://de.wikiactu.com741"m+xml" tGa214ileo Galilei">Galileo Galileirna>">/" e<21ile-inem-2Real Madrid-4Real Madridhref="http://de.wikiactu.com4871ym+xml" t6422ermittelhersteller">Futtermittelherstel6422ee-inem-2Real Verbrauchermarkt-4Real Verbrauchermarkthref="http://de.wikiactu.com4871ym+xml" t387dez">Gardezrna>">/" e<' />>
Galileo Galileirna>">/" e<744ile-inem-2Rebecca Harms-4Rebecca Harmsref="http://de.wikiactu.com741"m+xml" tGa294twangenytFurtwangenrna>">/" e<' />> Galileo Galileirna>">/" e<319ile-inem-2Recep Tayyip Erdoğan-4Recep Tayyip Erdoğanhref="http://de.wikiactu.com4871ym+xml" t79i0n Politik">Gabun Politikrna>">/" e<' />79i0ne-inem-2Recht auf Akteneinsicht-4Recht auf Akteneinsichthref="http://de.wikiactu.com4871ym+xml" t7110n Politik">Gabun Politikrna>">/" e<' />7110ne-inem-2Recht auf Leben-4Recht auf Lebenhref="http://de.wikiactu.com4871ym+xml" t597dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/79x1ie-inem-2Recht im Jemen-4Recht im Jemenhref="http://de.wikiactu.com4871ym+xml" t644al Mubarak">Gamal Mubarakrna>">/" e<' />644ale-inem-2Recht im Kosovo-4Recht im Kosovohref="http://de.wikiactu.com4871ym+xml" t852ermittelhersteller">Futtermittelherstel852ee-inem-2Recht im Saarland-4Recht im Saarlandref="http://de.wikiactu.com741"m+xml" tGa25ileo Galilei">Galileo Galileirna>">/" e<259ee-inem-2Recht im Senegal-4Recht im Senegalref="http://de.wikiactu.com741"m+xml" tGa921bisbre Politik">Gambisbre Politikrna>">/921bie-inem-2Recht im Tsytad-4Recht im Tsytadref="http://de.wikiactu.com741"m+xml" tGa184ileo Galilei">Galileo Galileirna>">/" e<184ile-inem-2Recht im Vereinigten Königreich-4Recht im Vereinigten Königreichhref="http://de.wikiactu.com4871ym+xml" t891un Politik">Gabun Politikrna>">/" e<' />89x1ie-inem-2Recht im Westjordanland-4Recht im Westjordanlandref="http://de.wikiactu.com741"m+xml" tGa2820n Politik">Gabun Politikrna>">/" e<' />2820ne-inem-2Recht in Afghanistan-4Recht in Afghanistanhref="http://de.wikiactu.com4871ym+xml" t654ball-Bundesliga dt. allg.">Fußball-Bun654be-inem-2Recht in Ägypten-4Recht in Ägyptenhref="http://de.wikiactu.com4871ym+xml" t6448isbre Politik">Gambisbre Politikrna>">/644twe-inem-2Recht in Albanien-4Recht in Albanienhref="http://de.wikiactu.com4871ym+xml" t7805isbre Politik">Gambisbre Politikrna>">/7805ie-inem-2Recht in Argentinien-4Recht in Argentinienref="http://de.wikiactu.com741"m+xml" tGa966ball-Bundesliga dt. allg.">Fußball-Bun966be-inem-2Recht in Asien-4Recht in Asienref="http://de.wikiactu.com741"m+xml" tGa9856leo Galilei">Galileo Galileirna>">/" e<9856le-inem-2Recht in Äthiopien-4Recht in Äthiopienhref="http://de.wikiactu.com4871ym+xml" t891tball-2.Bundesliga dt. (Spielbericht)ytF891twe-inem-2Recht in Australien-4Recht in Australienref="http://de.wikiactu.com741"m+xml" tGa29iburg im Üechtland">Freiburg im Üechtl292ie-inem-2Recht in Baden-Wüettemberg-4Recht in Baden-Wüettemberghref="http://de.wikiactu.com4871ym+xml" t7023isbre Politik">Gambisbre Politikrna>">/702ale-inem-2Recht in Bangladesch-4Recht in Bangladeschhref="http://de.wikiactu.com4871ym+xml" t86ileo Galilei">Galileo Galileirna>">/" e<86ile-inem-2Recht in Bayern-4Recht in Bayernhref="http://de.wikiactu.com4871ym+xml" t7000l Mubarak">Gamal Mubarakrna>">/" e<' />7000ne-inem-2Recht in Belgien-4Recht in Belgienhref="http://de.wikiactu.com4871ym+xml" t143tball-2.Bundesliga dt. (Spielbericht)ytF143twe-inem-2Recht in Berlin-4Recht in Berlinhref="http://de.wikiactu.com4871ym+xml" t706iburg im Üechtland">Freiburg im Üechtl706ibe-inem-2Recht in Bolivien-4Recht in Bolivienhref="http://de.wikiactu.com4871ym+xml" t6458ball-2.Bundesliga dt. (Spielbericht)ytF6458be-inem-2Recht in Bosnien und Herzegowina-4Recht in Bosnien und Herzegowinahref="http://de.wikiactu.com4871ym+xml" t571ball-Bundesliga dt. allg.">Fußball-Bun571be-inem-2Recht in Brandenburg-4Recht in Brandenburgref="http://de.wikiactu.com741"m+xml" tGa505un Politik">Gabun Politikrna>">/" e<' />505une-inem-2Recht in Bremen-4Recht in Bremenhref="http://de.wikiactu.com4871ym+xml" t646ball-Bundesliga dt. allg.">Fußball-Bun646be-inem-2Recht in Bulgarien-4Recht in Bulgarienhref="http://de.wikiactu.com4871ym+xml" t612ileo Galilei">Galileo Galileirna>">/" e<612ile-inem-2Recht in Chile-4Recht in Chileref="http://de.wikiactu.com741"m+xml" tGa220dez">Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />683ale-inem-2Recht in Dänemark-4Recht in Dänemarkref="http://de.wikiactu.com741"m+xml" tGa10i0n Politik">Gabun Politikrna>">/" e<' />10i0ne-inem-2Recht in den Niederlanden-4Recht in den Niederlandenref="http://de.wikiactu.com741"m+xml" tGa566un Politik">Gabun Politikrna>">/" e<' />566une-inem-2Recht in den Palästinensisytin Autonomiegebieten-4Recht in den Palästinensisytin Autonomiegebietenref="http://de.wikiactu.com741"m+xml" tGa27ball-Bundesliga dt. allg.">Fußball-Bun27be-inem-2Recht in den Vereinigten Staaten-4Recht in den Vereinigten Staatenhref="http://de.wikiactu.com4871ym+xml" t3727isbre Politik">Gambisbre Politikrna>">/372bie-inem-2Recht in der Europäisytin Union-4Recht in der Europäisytin Unionref="http://de.wikiactu.com741"m+xml" tGa555ileo Galilei">Galileo Galileirna>">/" e<555ile-inem-2Recht in der Sm weiz-4Recht in der Sm weizhref="http://de.wikiactu.com4871ym+xml" t65ibisbre Politik">Gambisbre Politikrna>">/659bie-inem-2Recht in der Slowakei-4Recht in der Slowakeihref="http://de.wikiactu.com4871ym+xml" t769wangenytFurtwangenrna>">/" e<' />> Fußball-Bun607be-inem-2Recht in der Ukraine-4Recht in der Ukraineref="http://de.wikiactu.com741"m+xml" tGa291isbre Politik">Gambisbre Politikrna>">/29une-inem-2Recht in Deutsytland-4Recht in Deutsytlandhref="http://de.wikiactu.com4871ym+xml" t368al Mubarak">Gamal Mubarakrna>">/" e<' />368ale-inem-2Recht in Europk-4Recht in Europkref="http://de.wikiactu.com741"m+xml" tGa541al Mubarak">Gamal Mubarakrna>">/" e<' />541ale-inem-2Recht in Finnland-4Recht in Finnlandref="http://de.wikiactu.com741"m+xml" tGa403ileo Galilei">Galileo Galileirna>">/" e<4039ie-inem-2Recht in Frankreich-4Recht in Frankreichref="http://de.wikiactu.com741"m+xml" tGa6731isbre Politik">Gambisbre Politikrna>">/6731ie-inem-2Recht in Georgien-4Recht in Georgienref="http://de.wikiactu.com741"m+xml" tGa555ball-Bundesliga dt. allg.">Fußball-Bun555be-inem-2Recht in Grieytinland-4Recht in Grieytinlandref="http://de.wikiactu.com741"m+xml" tGa569al Mubarak">Gamal Mubarakrna>">/" e<' />569ale-inem-2Recht in Guinea-Bissau-4Recht in Guinea-Bissauhref="http://de.wikiactu.com4871ym+xml" t7558ball-2.Bundesliga dt. (Spielbericht)ytF7558be-inem-2Recht in Haiti-4Recht in Haitiref="http://de.wikiactu.com741"m+xml" tGa625ermittelhersteller">Futtermittelherstel625ee-inem-2Recht in Hamburg-4Recht in Hamburgref="http://de.wikiactu.com741"m+xml" tGa200bisbre Politik">Gambisbre Politikrna>">/200bie-inem-2Recht in Hessen-4Recht in Hessenhref="http://de.wikiactu.com4871ym+xml" t7685isbre Politik">Gambisbre Politikrna>">/7685ie-inem-2Recht in Honduras-4Recht in Hondurasref="http://de.wikiactu.com741"m+xml" tGa552un Politik">Gabun Politikrna>">/" e<' />5521ie-inem-2Recht in Indien-4Recht in Indienhref="http://de.wikiactu.com4871ym+xml" t777ileo Galilei">Galileo Galileirna>">/" e<7779ie-inem-2Recht in Indonesien-4Recht in Indonesienhref="http://de.wikiactu.com4871ym+xml" t7837ez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />14i0ne-inem-2Recht in Italien-4Recht in Italienhref="http://de.wikiactu.com4871ym+xml" t6508isbre Politik">Gambisbre Politikrna>">/6508ie-inem-2Recht in Japan-4Recht in Japanhref="http://de.wikiactu.com4871ym+xml" t6185isbre Politik">Gambisbre Politikrna>">/6185ie-inem-2Recht in Kamerun-4Recht in Kamerunhref="http://de.wikiactu.com4871ym+xml" t798al Mubarak">Gamal Mubarakrna>">/" e<' />798ale-inem-2Recht in Kanada-4Recht in Kanadahref="http://de.wikiactu.com4871ym+xml" t8i6un Politik">Gabun Politikrna>">/" e<' />8i6une-inem-2Recht in Katar-4Recht in Katarhref="http://de.wikiactu.com4871ym+xml" t611ermittelhersteller">Futtermittelherstel611ee-inem-2Recht in Kolumbien-4Recht in Kolumbienhref="http://de.wikiactu.com4871ym+xml" t6523isbre Politik">Gambisbre Politikrna>">/652ale-inem-2Recht in Kroatien-4Recht in Kroatienhref="http://de.wikiactu.com4871ym+xml" t810dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />32i0ne-inem-2Recht in Liberia-4Recht in Liberiahref="http://de.wikiactu.com4871ym+xml" t420ermittelhersteller">Futtermittelherstel420ee-inem-2Recht in Liechtenstein-4Recht in Liechtensteinhref="http://de.wikiactu.com4871ym+xml" t640ermittelhersteller">Futtermittelherstel640ee-inem-2Recht in Madagaskar-4Recht in Madagaskarref="http://de.wikiactu.com741"m+xml" tGa941al Mubarak">Gamal Mubarakrna>">/" e<' />941ale-inem-2Recht in Mali-4Recht in Maliref="http://de.wikiactu.com741"m+xml" tGa9627isbre Politik">Gambisbre Politikrna>">/9627ie-inem-2Recht in Marokko-4Recht in Marokkohref="http://de.wikiactu.com4871ym+xml" t668dez">Gardezrna>">/" e<' />>
Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />455une-inem-2Recht in Mexiko-4Recht in Mexikoref="http://de.wikiactu.com741"m+xml" tGa5023isbre Politik">Gambisbre Politikrna>">/502ale-inem-2Recht in Myanmar-4Recht in Myanmarref="http://de.wikiactu.com741"m+xml" tGa521ermittelhersteller">Futtermittelherstel521ee-inem-2Recht in Neuseeland-4Recht in Neuseelandhref="http://de.wikiactu.com4871ym+xml" t176ball-Bundesliga dt. allg.">Fußball-Bun176be-inem-2Recht in Niedersachsen-4Recht in Niedersachsenref="http://de.wikiactu.com741"m+xml" tGa6091isbre Politik">Gambisbre Politikrna>">/6091ie-inem-2Recht in Niger-4Recht in Nigerhref="http://de.wikiactu.com4871ym+xml" t6157isbre Politik">Gambisbre Politikrna>">/6157ie-inem-2Recht in Nigeria-4Recht in Nigeriahref="http://de.wikiactu.com4871ym+xml" t337un Politik">Gabun Politikrna>">/" e<' />337une-inem-2Recht in Nordrhein-Westfalen-4Recht in Nordrhein-Westfalenhref="http://de.wikiactu.com4871ym+xml" t3267isbre Politik">Gambisbre Politikrna>">/3267ie-inem-2Recht in Norwegen-4Recht in Norwegenref="http://de.wikiactu.com741"m+xml" tGa5450n Politik">Gabun Politikrna>">/" e<' />5450ne-inem-2Recht in Österreich-4Recht in Österreichref="http://de.wikiactu.com741"m+xml" tGa986leo Galilei">Galileo Galileirna>">/" e<98dee-inem-2Recht in Pakistan-4Recht in Pakistanref="http://de.wikiactu.com741"m+xml" tGa26ibisbre Politik">Gambisbre Politikrna>">/26ibie-inem-2Recht in Polen-4Recht in Polenhref="http://de.wikiactu.com4871ym+xml" t343ermittelhersteller">Futtermittelherstel343ee-inem-2Recht in Portugal-4Recht in Portugalref="http://de.wikiactu.com741"m+xml" tGa536al Mubarak">Gamal Mubarakrna>">/" e<' />536ale-inem-2Recht in Rheinland-Pfalz-4Recht in Rheinland-Pfalzhref="http://de.wikiactu.com4871ym+xml" t423ermittelhersteller">Futtermittelherstel423ee-inem-2Recht in Russland-4Recht in Russlandref="http://de.wikiactu.com741"m+xml" tGa40ileo Galilei">Galileo Galileirna>">/" e<409ie-inem-2Recht in Sachsen-4Recht in Sachsenref="http://de.wikiactu.com741"m+xml" tGa539al Mubarak">Gamal Mubarakrna>">/" e<' />539ale-inem-2Recht in Sachsen-Anhalt-4Recht in Sachsen-Anhaltref="http://de.wikiactu.com741"m+xml" tGa200twangenytFurtwangenrna>">/" e<' />> Gabun Politikrna>">/" e<' />545une-inem-2Recht in Sm weden-4Recht in Sm wedenhref="http://de.wikiactu.com4871ym+xml" t6457isbre Politik">Gambisbre Politikrna>">/6457ie-inem-2Recht in Serbien-4Recht in Serbienref="http://de.wikiactu.com741"m+xml" tGa463dez">Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />282ale-inem-2Recht in Somalia-4Recht in Somaliaref="http://de.wikiactu.com741"m+xml" tGa4727isbre Politik">Gambisbre Politikrna>">/472bie-inem-2Recht in Spanien-4Recht in Spanienref="http://de.wikiactu.com741"m+xml" tGa606iburg im Üechtland">Freiburg im Üechtl606ibe-inem-2Recht in Sri Lanka-4Recht in Sri Lankaref="http://de.wikiactu.com741"m+xml" tGa580un Politik">Gabun Politikrna>">/" e<' />580une-inem-2Recht in Südafrika-4Recht in Südafrikahref="http://de.wikiactu.com4871ym+xml" t657ermittelhersteller">Futtermittelherstel657ee-inem-2Recht in Syrien-4Recht in Syrienref="http://de.wikiactu.com741"m+xml" tGa530un Politik">Gabun Politikrna>">/" e<' />530une-inem-2Recht in Thailand-4Recht in Thailandhref="http://de.wikiactu.com4871ym+xml" t4248isbre Politik">Gambisbre Politikrna>">/4248ie-inem-2Recht in Thüringen-4Recht in Thüringenhref="http://de.wikiactu.com4871ym+xml" t57ibisbre Politik">Gambisbre Politikrna>">/57ibie-inem-2Recht in Timor-Leste-4Recht in Timor-Lestehref="http://de.wikiactu.com4871ym+xml" t656ermittelhersteller">Futtermittelherstel656ee-inem-2Recht in Tsytechien-4Recht in Tsytechienref="http://de.wikiactu.com741"m+xml" tGa9460isbre Politik">Gambisbre Politikrna>">/9460ne-inem-2Recht in Tunesien-4Recht in Tunesienref="http://de.wikiactu.com741"m+xml" tGa9468isbre Politik">Gambisbre Politikrna>">/9468ie-inem-2Recht in Turkmenistan-4Recht in Turkmenistanhref="http://de.wikiactu.com4871ym+xml" t666un Politik">Gabun Politikrna>">/" e<' />666une-inem-2Recht in Ungarn-4Recht in Ungarnref="http://de.wikiactu.com741"m+xml" tGa961dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />9730ne-inem-2Recht in Weißrussland-4Recht in Weißrusslandhref="http://de.wikiactu.com4871ym+xml" t817bisbre Politik">Gambisbre Politikrna>">/817bie-inem-2Rechtsbeugung-4Rechtsbeugunghref="http://de.wikiactu.com4871ym+xml" t410n Politik">Gabun Politikrna>">/" e<' />410ne-inem-2Rechtsextremismus-4Rechtsextremismusref="http://de.wikiactu.com741"m+xml" tGa469ball-Bundesliga dt. allg.">Fußball-Bun469be-inem-2Rechtsmedizin-4Rechtsmedizinhref="http://de.wikiactu.com4871ym+xml" t339iburg im Üechtland">Freiburg im Üechtl339ibe-inem-2Rechtsrock-4Rechtsrockhref="http://de.wikiactu.com4871ym+xml" t87un Politik">Gabun Politikrna>">/" e<' />87une-inem-2Rechtssytutz-4Rechtssytutzhref="http://de.wikiactu.com4871ym+xml" t66ibisbre Politik">Gambisbre Politikrna>">/66ibie-inem-2Recklinghausen-4Recklinghausenref="http://de.wikiactu.com741"m+xml" tGa589al Mubarak">Gamal Mubarakrna>">/" e<' />589ale-inem-2Red Bull-4Red Bullref="http://de.wikiactu.com741"m+xml" tGa29ileo Galilei">Galileo Galileirna>">/" e<299le-inem-2Red Lake-4Red Lakehref="http://de.wikiactu.com4871ym+xml" t32b3isbre Politik">Gambisbre Politikrna>">/32b3ie-inem-2Redakteur-4Redakteurhref="http://de.wikiactu.com4871ym+xml" t8070n Politik">Gabun Politikrna>">/" e<' />8070ne-inem-2Redmond (Washington)-4Redmond (Washington)href="http://de.wikiactu.com4871ym+xml" t3867isbre Politik">Gambisbre Politikrna>">/3867ie-inem-2Reederei-4Reedereiref="http://de.wikiactu.com741"m+xml" tGa106ermittelhersteller">Futtermittelherstel106ee-inem-2Referendum-4Referendumref="http://de.wikiactu.com741"m+xml" tGa132dez">Gardezrna>">/" e<' />>
Galileo Galileirna>">/" e<794ile-inem-2Regau-4Regauhref="http://de.wikiactu.com4871ym+xml" t161bisbre Politik">Gambisbre Politikrna>">/161bie-inem-2Regen-4Regenhref="http://de.wikiactu.com4871ym+xml" t68bisbre Politik">Gambisbre Politikrna>">/68bie-inem-2Regensburg-4Regensburghref="http://de.wikiactu.com4871ym+xml" t645ileo Galilei">Galileo Galileirna>">/" e<645ile-inem-2Reggio Calabria-4Reggio Calabriaref="http://de.wikiactu.com741"m+xml" tGa188bisbre Politik">Gambisbre Politikrna>">/188bie-inem-2Reggio Emilia-4Reggio Emiliahref="http://de.wikiactu.com4871ym+xml" t61dez">Gardezrna>">/" e<' />>
Galileo Galileirna>">/" e<270ile-inem-2Regionaler Bahnverkehr-4Regionaler Bahnverkehrhref="http://de.wikiactu.com4871ym+xml" t351ball-Bundesliga dt. allg.">Fußball-Bun351be-inem-2Regionalwahl-4Regionalwahlref="http://de.wikiactu.com741"m+xml" tGa186un Politik">Gabun Politikrna>">/" e<' />186une-inem-2Regisseur-4Regisseurhref="http://de.wikiactu.com4871ym+xml" t896un Politik">Gabun Politikrna>">/" e<' />896une-inem-2Reh-4Rehhref="http://de.wikiactu.com4871ym+xml" t763iburg im Üechtland">Freiburg im Üechtl763ibe-inem-2Reichelsheim (Wetterau)-4Reichelsheim (Wetterau)href="http://de.wikiactu.com4871ym+xml" t843al Mubarak">Gamal Mubarakrna>">/" e<' />843ale-inem-2Reichswehr-4Reichswehrhref="http://de.wikiactu.com4871ym+xml" t176ileo Galilei">Galileo Galileirna>">/" e<1769ie-inem-2Reifenhersteller-4Reifenherstellerref="http://de.wikiactu.com741"m+xml" tGa982ileo Galilei">Galileo Galileirna>">/" e<982ile-inem-2Reimei-4Reimeihref="http://de.wikiactu.com4871ym+xml" t5785isbre Politik">Gambisbre Politikrna>">/5785ie-inem-2Reiner Sesselmann-4Reiner Sesselmannref="http://de.wikiactu.com741"m+xml" tGa290al Mubarak">Gamal Mubarakrna>">/" e<' />290ale-inem-2Reinhard Bütikofer-4Reinhard Bütikoferref="http://de.wikiactu.com741"m+xml" tGa223iburg im Üechtland">Freiburg im Üechtl223ibe-inem-2Reinhard Hauke-4Reinhard Haukeref="http://de.wikiactu.com741"m+xml" tGa2068isbre Politik">Gambisbre Politikrna>">/2068ie-inem-2Reinhard Krannich-4Reinhard Krannichhref="http://de.wikiactu.com4871ym+xml" t8920n Politik">Gabun Politikrna>">/" e<' />8920ne-inem-2Reinhard Löffler-4Reinhard Löfflerref="http://de.wikiactu.com741"m+xml" tGa961al Mubarak">Gamal Mubarakrna>">/" e<' />961ale-inem-2Reinhard Marx-4Reinhard Marxref="http://de.wikiactu.com741"m+xml" tGa4410n Politik">Gabun Politikrna>">/" e<' />4410ne-inem-2Reinhard Rauball-4Reinhard Rauballhref="http://de.wikiactu.com4871ym+xml" t766ball-Bundesliga dt. allg.">Fußball-Bun766be-inem-2Reinhardtsdorf-Schöna-4Reinhardtsdorf-Schönahref="http://de.wikiactu.com4871ym+xml" t3886leo Galilei">Galileo Galileirna>">/" e<3886le-inem-2Reinigungsunternehmen-4Reinigungsunternehmenhref="http://de.wikiactu.com4871ym+xml" t858ball-2.Bundesliga dt. (Spielbericht)ytF858be-inem-2Reis-4Reisref="http://de.wikiactu.com741"m+xml" tGa570un Politik">Gabun Politikrna>">/" e<' />570une-inem-2Reisebus-4Reisebusref="http://de.wikiactu.com741"m+xml" tGa6740l Mubarak">Gamal Mubarakrna>">/" e<' />6740le-inem-2Reiskiryten-4Reiskirytenhref="http://de.wikiactu.com4871ym+xml" t79dez">Gardezrna>">/" e<' />>
Futtermittelherstel638ee-inem-2Reken-4Rekenhref="http://de.wikiactu.com4871ym+xml" t165iburg im Üechtland">Freiburg im Üechtl165ibe-inem-2Rekord-4Rekordref="http://de.wikiactu.com741"m+xml" tGa5760isbre Politik">Gambisbre Politikrna>">/5760ie-inem-2Religion-4Religionhref="http://de.wikiactu.com4871ym+xml" t667ermittelhersteller">Futtermittelherstel667ee-inem-2Religion im Iran-4Religion im Iranhref="http://de.wikiactu.com4871ym+xml" t697bring b.Münbren">Garbring b.Münbrenrna697bre-inem-2Religion in China-4Religion in Chinahref="http://de.wikiactu.com4871ym+xml" t894un Politik">Gabun Politikrna>">/" e<' />894une-inem-2Religion in Russland-4Religion in Russlandhref="http://de.wikiactu.com4871ym+xml" t7586leo Galilei">Galileo Galileirna>">/" e<7586le-inem-2Religionslehre-4Religionslehreref="http://de.wikiactu.com741"m+xml" tGa909al Mubarak">Gamal Mubarakrna>">/" e<' />909ale-inem-2Religionspolizei-4Religionspolizeiref="http://de.wikiactu.com741"m+xml" tGa638dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />5480ne-inem-2Religionswissensytaft-4Religionswissensytaftref="http://de.wikiactu.com741"m+xml" tGa966dez">Gardezrna>">/" e<' />>
Futtermittelherstel222ee-inem-2Religiöser Brauch-4Religiöser Brauchhref="http://de.wikiactu.com4871ym+xml" t7550l Mubarak">Gamal Mubarakrna>">/" e<' />7550ne-inem-2Remzi Kartal-4Remzi Kartalhref="http://de.wikiactu.com4871ym+xml" t895ball-Bundesliga dt. allg.">Fußball-Bun895be-inem-2Renamo-4Renamohref="http://de.wikiactu.com4871ym+xml" t3670n Politik">Gabun Politikrna>">/" e<' />3670ne-inem-2Renate Götsytl-4Renate Götsytlhref="http://de.wikiactu.com4871ym+xml" t199twangenytFurtwangenrna>">/" e<' />> Freiburg im Üechtl199ibe-inem-2Renate Schmidt-4Renate Schmidtref="http://de.wikiactu.com741"m+xml" tGa675isbre Politik">Gambisbre Politikrna>">/67be-inem-2Renault-4Renaultref="http://de.wikiactu.com741"m+xml" tGa593tball-2.Bundesliga dt. (Spielbericht)ytF593tbe-inem-2René Ngongo-4René Ngongoref="http://de.wikiactu.com741"m+xml" tGa504al Mubarak">Gamal Mubarakrna>">/" e<' />504ale-inem-2René Obermann-4René Obermannref="http://de.wikiactu.com741"m+xml" tGa968ermittelhersteller">Futtermittelherstel968ee-inem-2Rennau-4Rennauhref="http://de.wikiactu.com4871ym+xml" t896ball-Bundesliga dt. allg.">Fußball-Bun896be-inem-2Rennrodel-Weltcup-4Rennrodel-Weltcuphref="http://de.wikiactu.com4871ym+xml" t1218ball-2.Bundesliga dt. (Spielbericht)ytF121twe-inem-2Rennsteigbahn-4Rennsteigbahnref="http://de.wikiactu.com741"m+xml" tGa1831isbre Politik">Gambisbre Politikrna>">/1831ie-inem-2Rente-4Rentehref="http://de.wikiactu.com4871ym+xml" t732un Politik">Gabun Politikrna>">/" e<' />7321ie-inem-2Rentnerpartei-4Rentnerparteiref="http://de.wikiactu.com741"m+xml" tGa40i2isbre Politik">Gambisbre Politikrna>">/409ibe-inem-2Reorganisation-4Reorganisationref="http://de.wikiactu.com741"m+xml" tGa4057isbre Politik">Gambisbre Politikrna>">/4057ie-inem-2REP-4REPref="http://de.wikiactu.com741"m+xml" tGa404iburg im Üechtland">Freiburg im Üechtl404ibe-inem-2Reporter ohne Grenzen-4Reporter ohne Grenzenref="http://de.wikiactu.com741"m+xml" tGa443ileo Galilei">Galileo Galileirna>">/" e<4439ie-inem-2Reproduktionsmedizin-4Reproduktionsmedizinhref="http://de.wikiactu.com4871ym+xml" t6605isbre Politik">Gambisbre Politikrna>">/6605ie-inem-2Reptil-4Reptilref="http://de.wikiactu.com741"m+xml" tGa205ermittelhersteller">Futtermittelherstel205ee-inem-2Republican Party-4Republican Partyref="http://de.wikiactu.com741"m+xml" tGa9285isbre Politik">Gambisbre Politikrna>">/9285ie-inem-2Republik Kongo-4Republik Kongohref="http://de.wikiactu.com4871ym+xml" t753iburg im Üechtland">Freiburg im Üechtl753ibe-inem-2Research Casting International-4Research Casting Internationalhref="http://de.wikiactu.com4871ym+xml" t160ermittelhersteller">Futtermittelherstel160ee-inem-2Restaurierung-4Restaurierunghref="http://de.wikiactu.com4871ym+xml" t771ermittelhersteller">Futtermittelherstel771ee-inem-2Reston-4Restonhref="http://de.wikiactu.com4871ym+xml" t79dermittelhersteller">Futtermittelherstel796ee-inem-2Rettungsdienst-4Rettungsdiensthref="http://de.wikiactu.com4871ym+xml" t110iburg im Üechtland">Freiburg im Üechtl110ibe-inem-2Rettungseinsatz (Hubsytrauber)-4Rettungseinsatz (Hubsytrauber)ref="http://de.wikiactu.com741"m+xml" tGa213dez">Gardezrna>">/" e<' />>
Galileo Galileirna>">/" e<63ile-inem-2Rettungstransport-4Rettungstransporthref="http://de.wikiactu.com4871ym+xml" t7838isbre Politik">Gambisbre Politikrna>">/7838ie-inem-2Reuben Rivlin-4Reuben Rivlinhref="http://de.wikiactu.com4871ym+xml" t855ball-Bundesliga dt. allg.">Fußball-Bun855be-inem-2Réunion-4Réunionref="http://de.wikiactu.com741"m+xml" tGa550bisbre Politik">Gambisbre Politikrna>">/550bie-inem-2Reutlingen-4Reutlingenref="http://de.wikiactu.com741"m+xml" tGa518iburg im Üechtland">Freiburg im Üechtl518ibe-inem-2REVA-4REVAref="http://de.wikiactu.com741"m+xml" tGa441ball-Bundesliga dt. allg.">Fußball-Bun441be-inem-2Revel-4Revelhref="http://de.wikiactu.com4871ym+xml" t537ileo Galilei">Galileo Galileirna>">/" e<537ile-inem-2Revierderby-4Revierderbyhref="http://de.wikiactu.com4871ym+xml" t61ddez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />781ie-inem-2Rezept-4Rezepthref="http://de.wikiactu.com4871ym+xml" t8975isbre Politik">Gambisbre Politikrna>">/8975ie-inem-2Rezzo Schlauch-4Rezzo Schlauchhref="http://de.wikiactu.com4871ym+xml" t3437isbre Politik">Gambisbre Politikrna>">/3437ee-inem-2Rhede (Ems)-4Rhede (Ems)ref="http://de.wikiactu.com741"m+xml" tGa288dez">Gardezrna>">/" e<' />>
Freiburg im Üechtl284ibe-inem-2Rhein-Main-Flughafen-4Rhein-Main-Flughafenhref="http://de.wikiactu.com4871ym+xml" t7378isbre Politik">Gambisbre Politikrna>">/7378ie-inem-2Rheinfelden (Baden)-4Rheinfelden (Baden)ref="http://de.wikiactu.com741"m+xml" tGa5823isbre Politik">Gambisbre Politikrna>">/582ale-inem-2Rheinisyti Friedrich-Wilhelms-Universität Bonn-4Rheinisyti Friedrich-Wilhelms-Universität Bonnhref="http://de.wikiactu.com4871ym+xml" t719twangenytFurtwangenrna>">/" e<' />> Gambisbre Politikrna>">/790bie-inem-2Rhythm Combination & Brass-4Rhythm Combination & Brassref="http://de.wikiactu.com741"m+xml" tGa2250l Mubarak">Gamal Mubarakrna>">/" e<' />2250le-inem-2Riad-4Riadref="http://de.wikiactu.com741"m+xml" tGa8110n Politik">Gabun Politikrna>">/" e<' />8110ne-inem-2Ricardo Duran-4Ricardo Duranhref="http://de.wikiactu.com4871ym+xml" t716al Mubarak">Gamal Mubarakrna>">/" e<' />716ale-inem-2Ricardo Lagos-4Ricardo Lagosref="http://de.wikiactu.com741"m+xml" tGa401un Politik">Gabun Politikrna>">/" e<' />401une-inem-2Ricardo Zonta-4Ricardo Zontaref="http://de.wikiactu.com741"m+xml" tGa238dez">Gardezrna>">/" e<' />>
Galileo Galileirna>">/" e<8469ie-inem-2Ricco Groß-4Ricco Großref="http://de.wikiactu.com741"m+xml" tGa91ermittelhersteller">Futtermittelherstel91ee-inem-2Richard Branson-4Richard Bransonref="http://de.wikiactu.com741"m+xml" tGa203ball-Bundesliga dt. allg.">Fußball-Bun203be-inem-2Richard Cheney-4Richard Cheneyref="http://de.wikiactu.com741"m+xml" tGa952dez">Gardezrna>">/" e<' />>
Fußball-Bun238be-inem-2Richard Leigh-4Richard Leighref="http://de.wikiactu.com741"m+xml" tGa819twangenytFurtwangenrna>">/" e<' />> Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/112bie-inem-2Richter-4Richterref="http://de.wikiactu.com741"m+xml" tGa8625isbre Politik">Gambisbre Politikrna>">/8625ie-inem-2Rick Perry-4Rick Perryref="http://de.wikiactu.com741"m+xml" tGa838un Politik">Gabun Politikrna>">/" e<' />838une-inem-2Rick Santorum-4Rick Santorumref="http://de.wikiactu.com741"m+xml" tGa960ermittelhersteller">Futtermittelherstel960ee-inem-2Riedenburg-4Riedenburghref="http://de.wikiactu.com4871ym+xml" t770ermittelhersteller">Futtermittelherstel770ee-inem-2Riedlingen-4Riedlingenref="http://de.wikiactu.com741"m+xml" tGa278twangenytFurtwangenrna>">/" e<' />> Gabun Politikrna>">/" e<' />898une-inem-2Riesa-4Riesaref="http://de.wikiactu.com741"m+xml" tGa44ileo Galilei">Galileo Galileirna>">/" e<444ile-inem-2Rieschweiler-Mühlbach-4Rieschweiler-Mühlbachref="http://de.wikiactu.com741"m+xml" tGa818iburg im Üechtland">Freiburg im Üechtl818ibe-inem-2Riga-4Rigahref="http://de.wikiactu.com4871ym+xml" t898al Mubarak">Gamal Mubarakrna>">/" e<' />898ale-inem-2Rimbach-4Rimbachref="http://de.wikiactu.com741"m+xml" tGa16a1isbre Politik">Gambisbre Politikrna>">/1631ie-inem-2Rind-4Rindhref="http://de.wikiactu.com4871ym+xml" t3140l Mubarak">Gamal Mubarakrna>">/" e<' />3140le-inem-2Ringkøbing-4Ringkøbinghref="http://de.wikiactu.com4871ym+xml" t17ibisbre Politik">Gambisbre Politikrna>">/17ibie-inem-2Rio de Janeiro-4Rio de Janeiroref="http://de.wikiactu.com741"m+xml" tGa109iburg im Üechtland">Freiburg im Üechtl109ibe-inem-2Rita Verdonk-4Rita Verdonkhref="http://de.wikiactu.com4871ym+xml" t731ball-Bundesliga dt. allg.">Fußball-Bun731be-inem-2Ritterhude-4Ritterhuderef="http://de.wikiactu.com741"m+xml" tGa558iburg im Üechtland">Freiburg im Üechtl558ibe-inem-2Riverside-4Riversidehref="http://de.wikiactu.com4871ym+xml" t318ermittelhersteller">Futtermittelherstel318ee-inem-2RKK Energija-4RKK Energijahref="http://de.wikiactu.com4871ym+xml" t970un Politik">Gabun Politikrna>">/" e<' />970une-inem-2Rob Levin-4Rob Levinref="http://de.wikiactu.com741"m+xml" tGa256iburg im Üechtland">Freiburg im Üechtl256ibe-inem-2Robbe-4Robbehref="http://de.wikiactu.com4871ym+xml" t472dez">Gardezrna>">/" e<' />>
Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />2970ne-inem-2Robert Enke-4Robert Enkeref="http://de.wikiactu.com741"m+xml" tGa205al Mubarak">Gamal Mubarakrna>">/" e<' />205ale-inem-2Robert Gates-4Robert Gateshref="http://de.wikiactu.com4871ym+xml" t113ball-Bundesliga dt. allg.">Fußball-Bun113be-inem-2Robert Hoyzer-4Robert Hoyzerref="http://de.wikiactu.com741"m+xml" tGa2557isbre Politik">Gambisbre Politikrna>">/2557ie-inem-2Robert Hunter-4Robert Hunterhref="http://de.wikiactu.com4871ym+xml" t380ermittelhersteller">Futtermittelherstel380ee-inem-2Robert Huth-4Robert Huthref="http://de.wikiactu.com741"m+xml" tGa660un Politik">Gabun Politikrna>">/" e<' />660une-inem-2Robert Kalinak-4Robert Kalinakhref="http://de.wikiactu.com4871ym+xml" t459ball-Bundesliga dt. allg.">Fußball-Bun459be-inem-2Robert Koch-Ins-inut-4Robert Koch-Ins-inutref="http://de.wikiactu.com741"m+xml" tGa4418isbre Politik">Gambisbre Politikrna>">/4418ie-inem-2Robert Mugabe-4Robert Mugaberef="http://de.wikiactu.com741"m+xml" tGa229twangenytFurtwangenrna>">/" e<' />> Freiburg im Üechtl2972we-inem-2Roberto Hilbert-4Roberto Hilbertref="http://de.wikiactu.com741"m+xml" tGa588iburg im Üechtland">Freiburg im Üechtl5882we-inem-2Roberto Micheletti-4Roberto Michelettihref="http://de.wikiactu.com4871ym+xml" t721dez">Gardezrna>">/" e<' />>
Fußball-Bun329be-inem-2Robin Cook-4Robin Cookhref="http://de.wikiactu.com4871ym+xml" t6470n Politik">Gabun Politikrna>">/" e<' />6470ne-inem-2Robin Gibb-4Robin Gibbref="http://de.wikiactu.com741"m+xml" tGa229al Mubarak">Gamal Mubarakrna>">/" e<' />2293ne-inem-2Robinho-4Robinhohref="http://de.wikiactu.com4871ym+xml" t308ermittelhersteller">Futtermittelherstel3084ne-inem-2Robinson Helicopter-4Robinson Helicopterref="http://de.wikiactu.com741"m+xml" tGa956al Mubarak">Gamal Mubarakrna>">/" e<' />956ale-inem-2Robotertechnik-4Robotertechnikhref="http://de.wikiactu.com4871ym+xml" t329iburg im Üechtland">Freiburg im Üechtl3292ie-inem-2Rochester (Minnesota)-4Rochester (Minnesota)href="http://de.wikiactu.com4871ym+xml" t35twangenytFurtwangenrna>">/" e<' />> Galileo Galileirna>">/" e<9779ie-inem-2Rocketplane Kistler-4Rocketplane Kistlerref="http://de.wikiactu.com741"m+xml" tGa184un Politik">Gabun Politikrna>">/" e<' />184une-inem-2Rockot-4Rockotref="http://de.wikiactu.com741"m+xml" tGa9310n Politik">Gabun Politikrna>">/" e<' />9310ne-inem-2Rockville (Maryland)-4Rockville (Maryland)ref="http://de.wikiactu.com741"m+xml" tGa950un Politik">Gabun Politikrna>">/" e<' />950une-inem-2Rod Blagojevich-4Rod Blagojevichref="http://de.wikiactu.com741"m+xml" tGa4691isbre Politik">Gambisbre Politikrna>">/4691ie-inem-2Rod Paige-4Rod Paigehref="http://de.wikiactu.com4871ym+xml" t792twangenytFurtwangenrna>">/" e<' />> Fußball-Bun809be-inem-2Rodalben-4Rodalbenref="http://de.wikiactu.com741"m+xml" tGa554un Politik">Gabun Politikrna>">/" e<' />554une-inem-2Rodeln-4Rodelnhref="http://de.wikiactu.com4871ym+xml" t387iburg im Üechtland">Freiburg im Üechtl387ibe-inem-2Rodenbach-4Rodenbachhref="http://de.wikiactu.com4871ym+xml" t7757isbre Politik">Gambisbre Politikrna>">/7757ie-inem-2Rodrigo Rato-4Rodrigo Ratohref="http://de.wikiactu.com4871ym+xml" t877ileo Galilei">Galileo Galileirna>">/" e<8779ie-inem-2Rodwell Munyenyembe-4Rodwell Munyenyemberef="http://de.wikiactu.com741"m+xml" tGa5080n Politik">Gabun Politikrna>">/" e<' />5080ne-inem-2Roermond-4Roermondhref="http://de.wikiactu.com4871ym+xml" t314ileo Galilei">Galileo Galileirna>">/" e<314ile-inem-2Roger Moore-4Roger Mooreref="http://de.wikiactu.com741"m+xml" tGa134al Mubarak">Gamal Mubarakrna>">/" e<' />134ale-inem-2Roger Taylor-4Roger Taylorref="http://de.wikiactu.com741"m+xml" tGa8667isbre Politik">Gambisbre Politikrna>">/8667ie-inem-2Roh Moo Hyun-4Roh Moo Hyunref="http://de.wikiactu.com741"m+xml" tGa636ermittelhersteller">Futtermittelherstel636ee-inem-2Roh Moo-hyun-4Roh Moo-hyunref="http://de.wikiactu.com741"m+xml" tGa566al Mubarak">Gamal Mubarakrna>">/" e<' />566ale-inem-2Rohingya-4Rohingyahref="http://de.wikiactu.com4871ym+xml" t734un Politik">Gabun Politikrna>">/" e<' />734une-inem-2Rohukula-4Rohukulahref="http://de.wikiactu.com4871ym+xml" t704un Politik">Gabun Politikrna>">/" e<' />704une-inem-2Rola El-Halabi-4Rola El-Halabiref="http://de.wikiactu.com741"m+xml" tGa4905isbre Politik">Gambisbre Politikrna>">/4905ie-inem-2Roland Borer-4Roland Borerhref="http://de.wikiactu.com4871ym+xml" t5327isbre Politik">Gambisbre Politikrna>">/5327ie-inem-2Roland Fleck-4Roland Fleckref="http://de.wikiactu.com741"m+xml" tGa42ermittelhersteller">Futtermittelherstel42ee-inem-2Roland Koch-4Roland Kochref="http://de.wikiactu.com741"m+xml" tGa825ball-Bundesliga dt. allg.">Fußball-Bun8255ie-inem-2Rolf Breuer-4Rolf Breuerref="http://de.wikiactu.com741"m+xml" tGa558dez">Gardezrna>">/" e<' />>
Freiburg im Üechtl899ibe-inem-2Rolls-Royce-4Rolls-Royceref="http://de.wikiactu.com741"m+xml" tGa235ball-2.Bundesliga dt. (Spielbericht)ytF235be-inem-2Rom-4Romref="http://de.wikiactu.com741"m+xml" tGa664iburg im Üechtland">Freiburg im Üechtl664ibe-inem-2Roma-4Romahref="http://de.wikiactu.com4871ym+xml" t3130n Politik">Gabun Politikrna>">/" e<' />3130ne-inem-2Roman-4Romanhref="http://de.wikiactu.com4871ym+xml" t740dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/183ee-inem-2Roman Polanski-4Roman Polanskiref="http://de.wikiactu.com741"m+xml" tGa148ermittelhersteller">Futtermittelherstel148ee-inem-2Romano Prodi-4Romano Prodiref="http://de.wikiactu.com741"m+xml" tGa903al Mubarak">Gamal Mubarakrna>">/" e<' />903ale-inem-2Römerberg-4Römerberghref="http://de.wikiactu.com4871ym+xml" t160bisbre Politik">Gambisbre Politikrna>">/160bie-inem-2Römisyt-Katholisyti Kiryte-4Römisyt-Katholisyti Kiryteref="http://de.wikiactu.com741"m+xml" tGa6820n Politik">Gabun Politikrna>">/" e<' />6820ne-inem-2Römisyt-katholisyti Kiryte in Deutsytland-4Römisyt-katholisyti Kiryte in Deutsytlandhref="http://de.wikiactu.com4871ym+xml" t4780n Politik">Gabun Politikrna>">/" e<' />4780ne-inem-2Römisyt-Katholisytir Geistlicher-4Römisyt-Katholisytir Geistlicherhref="http://de.wikiactu.com4871ym+xml" t853dez">Gardezrna>">/" e<' />>
Futtermittelherstel110ee-inem-2Ron Dennis-4Ron Dennisref="http://de.wikiactu.com741"m+xml" tGa838al Mubarak">Gamal Mubarakrna>">/" e<' />8383ee-inem-2Ron Paul-4Ron Paulref="http://de.wikiactu.com741"m+xml" tGa9378isbre Politik">Gambisbre Politikrna>">/9378ie-inem-2Ron Sommer-4Ron Sommerref="http://de.wikiactu.com741"m+xml" tGa59iburg im Üechtland">Freiburg im Üechtl59ibe-inem-2Ronald Pofalla-4Ronald Pofallahref="http://de.wikiactu.com4871ym+xml" t368bisbre Politik">Gambisbre Politikrna>">/368bie-inem-2Ronald Reagan-4Ronald Reaganhref="http://de.wikiactu.com4871ym+xml" t757ermittelhersteller">Futtermittelherstel757ee-inem-2Ronald Sytill-4Ronald Sytillref="http://de.wikiactu.com741"m+xml" tGa990dez">Gardezrna>">/" e<' />>
Fußball-Bun181be-inem-2Rondonópolis-4Rondonópolisref="http://de.wikiactu.com741"m+xml" tGa554al Mubarak">Gamal Mubarakrna>">/" e<' />554ale-inem-2Ronny Ackermann-4Ronny Ackermannhref="http://de.wikiactu.com4871ym+xml" t8567isbre Politik">Gambisbre Politikrna>">/856bie-inem-2Röntgentechnik-4Röntgentechnikref="http://de.wikiactu.com741"m+xml" tGa926iburg im Üechtland">Freiburg im Üechtl926ibe-inem-2Rosalia AG-4Rosalia AGref="http://de.wikiactu.com741"m+xml" tGa675ball-Bundesliga dt. allg.">Fußball-Bun675be-inem-2ROSAT-4ROSAThref="http://de.wikiactu.com4871ym+xml" t896ileo Galilei">Galileo Galileirna>">/" e<8969ie-inem-2Roseau-4Roseauhref="http://de.wikiactu.com4871ym+xml" t642dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />697une-inem-2Rosenheim-4Rosenheimref="http://de.wikiactu.com741"m+xml" tGa231al Mubarak">Gamal Mubarakrna>">/" e<' />231ale-inem-2Rosetta (Sonde)-4Rosetta (Sonde)href="http://de.wikiactu.com4871ym+xml" t9708isbre Politik">Gambisbre Politikrna>">/9708ie-inem-2Rositz-4Rositzref="http://de.wikiactu.com741"m+xml" tGa180bisbre Politik">Gambisbre Politikrna>">/180bie-inem-2Roskosmos-4Roskosmoshref="http://de.wikiactu.com4871ym+xml" t8570n Politik">Gabun Politikrna>">/" e<' />8570ne-inem-2Rösrath-4Rösrathref="http://de.wikiactu.com741"m+xml" tGa146iburg im Üechtland">Freiburg im Üechtl146ibe-inem-2Rostock-4Rostockref="http://de.wikiactu.com741"m+xml" tGa900dez">Gardezrna>">/" e<' />>
Freiburg im Üechtl467ibe-inem-2Roswitha Müller-Piepenkötter-4Roswitha Müller-Piepenkötterhref="http://de.wikiactu.com4871ym+xml" t791bisbre Politik">Gambisbre Politikrna>">/791bie-inem-2Rot-Weiss Essen-4Rot-Weiss Essenref="http://de.wikiactu.com741"m+xml" tGa254dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/899be-inem-2Rotenburg (Wümme)-4Rotenburg (Wümme)ref="http://de.wikiactu.com741"m+xml" tGa267ermittelhersteller">Futtermittelherstel267ee-inem-2Rotenburg an der Fulda-4Rotenburg an der Fuldahref="http://de.wikiactu.com4871ym+xml" t899dez">Gardezrna>">/" e<' />>
Freiburg im Üechtl118ibe-inem-2Rotes Kreuz-4Rotes Kreuzref="http://de.wikiactu.com741"m+xml" tGa6870n Politik">Gabun Politikrna>">/" e<' />6870ne-inem-2Rothenburg ob der Tauber-4Rothenburg ob der Tauberhref="http://de.wikiactu.com4871ym+xml" t798iburg im Üechtland">Freiburg im Üechtl798ibe-inem-2Rottayt-Egern-4Rottayt-Egernref="http://de.wikiactu.com741"m+xml" tGa285ermittelhersteller">Futtermittelherstel285ee-inem-2Rotterdam-4Rotterdamref="http://de.wikiactu.com741"m+xml" tGa418twangenytFurtwangenrna>">/" e<' />> Gamal Mubarakrna>">/" e<' />245ale-inem-2Round Rock-4Round Rockhref="http://de.wikiactu.com4871ym+xml" t8505isbre Politik">Gambisbre Politikrna>">/8505ie-inem-2Rövershagen-4Rövershagenhref="http://de.wikiactu.com4871ym+xml" t754ileo Galilei">Galileo Galileirna>">/" e<754ile-inem-2Rowan Atkinson-4Rowan Atkinsonref="http://de.wikiactu.com741"m+xml" tGa9290n Politik">Gabun Politikrna>">/" e<' />9290ne-inem-2Rowenta-4Rowentaref="http://de.wikiactu.com741"m+xml" tGa256ermittelhersteller">Futtermittelherstel256ee-inem-2Roy Makaay-4Roy Makaayref="http://de.wikiactu.com741"m+xml" tGa934bisbre Politik">Gambisbre Politikrna>">/934bie-inem-2Royal Air Force-4Royal Air Forcehref="http://de.wikiactu.com4871ym+xml" t321ball-Bundesliga dt. allg.">Fußball-Bun321be-inem-2Royal Dutch Shell-4Royal Dutch Shellref="http://de.wikiactu.com741"m+xml" tGa980al Mubarak">Gamal Mubarakrna>">/" e<' />980ale-inem-2Royal Karayti Airlines-4Royal Karayti Airlinesref="http://de.wikiactu.com741"m+xml" tGa823al Mubarak">Gamal Mubarakrna>">/" e<' />823ale-inem-2Rozzano-4Rozzanoref="http://de.wikiactu.com741"m+xml" tGa8618isbre Politik">Gambisbre Politikrna>">/8618ie-inem-2RPT-4RPThref="http://de.wikiactu.com4871ym+xml" t910ermittelhersteller">Futtermittelherstel910ee-inem-2RTBF-4RTBFhref="http://de.wikiactu.com4871ym+xml" t33iburg im Üechtland">Freiburg im Üechtl33ibe-inem-2RTL-4RTLhref="http://de.wikiactu.com4871ym+xml" t333isbre Politik">Gambisbre Politikrna>">/33ale-inem-2RTL 2-4RTL 2href="http://de.wikiactu.com4871ym+xml" t890un Politik">Gabun Politikrna>">/" e<' />890une-inem-2RTL Group-4RTL Groupref="http://de.wikiactu.com741"m+xml" tGa20a1isbre Politik">Gambisbre Politikrna>">/20a1ie-inem-2Ruandisyte Politik-4Ruandisyte Politikref="http://de.wikiactu.com741"m+xml" tGa4010n Politik">Gabun Politikrna>">/" e<' />4010ne-inem-2Rubens Barrichello-4Rubens Barrichelloref="http://de.wikiactu.com741"m+xml" tGa951un Politik">Gabun Politikrna>">/" e<' />951une-inem-2Ruby Dee-4Ruby Deehref="http://de.wikiactu.com4871ym+xml" t17iermittelhersteller">Futtermittelherstel17iee-inem-2Rückrufaktion-4Rückrufaktionhref="http://de.wikiactu.com4871ym+xml" t915ball-Bundesliga dt. allg.">Fußball-Bun915be-inem-2Ruda Śląska-4Ruda Śląskahref="http://de.wikiactu.com4871ym+xml" t39ileo Galilei">Galileo Galileirna>">/" e<399le-inem-2Rüdesheim am Rhein-4Rüdesheim am Rheinhref="http://de.wikiactu.com4871ym+xml" t8850l Mubarak">Gamal Mubarakrna>">/" e<' />8850le-inem-2Rudi Assauer-4Rudi Assauerhref="http://de.wikiactu.com4871ym+xml" t34ddez">Gardezrna>">/" e<' />>
Gardezrna>">/" e<' />>
Galileo Galileirna>">/" e<9039le-inem-2Rüdiger Wolfrum-4Rüdiger Wolfrumref="http://de.wikiactu.com741"m+xml" tGa2735ball-2.Bundesliga dt. (Spielbericht)ytF273be-inem-2Rudolf Blechschmidt-4Rudolf Blechschmidthref="http://de.wikiactu.com4871ym+xml" t87al Mubarak">Gamal Mubarakrna>">/" e<' />8b3ie-inem-2Rudolf Heß-4Rudolf Heßhref="http://de.wikiactu.com4871ym+xml" t8745isbre Politik">Gambisbre Politikrna>">/8745ie-inem-2Rudolf Scharping-4Rudolf Scharpingref="http://de.wikiactu.com741"m+xml" tGa600un Politik">Gabun Politikrna>">/" e<' />600une-inem-2Rudolph Moshammer-4Rudolph Moshammerhref="http://de.wikiactu.com4871ym+xml" t39i0n Politik">Gabun Politikrna>">/" e<' />3990ne-inem-2Rudolstadt-4Rudolstadthref="http://de.wikiactu.com4871ym+xml" t312ileo Galilei">Galileo Galileirna>">/" e<312ile-inem-2Rudyard Kipling-4Rudyard Kiplinghref="http://de.wikiactu.com4871ym+xml" t778iburg im Üechtland">Freiburg im Üechtl778ibe-inem-2Rufschädigung-4Rufschädigungref="http://de.wikiactu.com741"m+xml" tGa837bisbre Politik">Gambisbre Politikrna>">/837bie-inem-2Rügen-4Rügenhref="http://de.wikiactu.com4871ym+xml" t968un Politik">Gabun Politikrna>">/" e<' />968une-inem-2Ruhpolding-4Ruhpoldingref="http://de.wikiactu.com741"m+xml" tGa633ermittelhersteller">Futtermittelherstel633ee-inem-2Rumänien-4Rumänienhref="http://de.wikiactu.com4871ym+xml" t7908isbre Politik">Gambisbre Politikrna>">/7908ie-inem-2Rumänisyte Personalie-4Rumänisyte Personalieref="http://de.wikiactu.com741"m+xml" tGa900iburg im Üechtland">Freiburg im Üechtl900ibe-inem-2Rumänisyte Wirtsytaft-4Rumänisyte Wirtsytaftref="http://de.wikiactu.com741"m+xml" tGa900un Politik">Gabun Politikrna>">/" e<' />900une-inem-2Rumänisytes Militärwesen-4Rumänisytes Militärwesenhref="http://de.wikiactu.com4871ym+xml" t78al Mubarak">Gamal Mubarakrna>">/" e<' />783ee-inem-2Rundfunkrecht-4Rundfunkrechthref="http://de.wikiactu.com4871ym+xml" t315ermittelhersteller">Futtermittelherstel315ee-inem-2Rundfunksender-4Rundfunksenderref="http://de.wikiactu.com741"m+xml" tGa212ileo Galilei">Galileo Galileirna>">/" e<212ile-inem-2Rupert Murdoch-4Rupert Murdochhref="http://de.wikiactu.com4871ym+xml" t724ermittelhersteller">Futtermittelherstel724ee-inem-2Ruprecht Polenz-4Ruprecht Polenzref="http://de.wikiactu.com741"m+xml" tGa865iburg im Üechtland">Freiburg im Üechtl865ibe-inem-2Ruslan Chagayev-4Ruslan Chagayevhref="http://de.wikiactu.com4871ym+xml" t797iburg im Üechtland">Freiburg im Üechtl7972we-inem-2Russe-4Russeref="http://de.wikiactu.com741"m+xml" tGa432un Politik">Gabun Politikrna>">/" e<' />4321ie-inem-2Rüsselsheim-4Rüsselsheimref="http://de.wikiactu.com741"m+xml" tGa901ileo Galilei">Galileo Galileirna>">/" e<9019we-inem-2Russisyte Akademie der Wissensytaften-4Russisyte Akademie der Wissensytaftenhref="http://de.wikiactu.com4871ym+xml" t303iburg im Üechtland">Freiburg im Üechtl3032we-inem-2Russisyte Außenpolitik-4Russisyte Außenpolitikref="http://de.wikiactu.com741"m+xml" tGa516ileo Galilei">Galileo Galileirna>">/" e<516ile-inem-2Russisyte Fußballnationalmannsytaft-4Russisyte Fußballnationalmannsytafthref="http://de.wikiactu.com4871ym+xml" t170n Politik">Gabun Politikrna>">/" e<' />170ne-inem-2Russisyte Personalie-4Russisyte Personaliehref="http://de.wikiactu.com4871ym+xml" t372dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />630une-inem-2Rustenburg-4Rustenburghref="http://de.wikiactu.com4871ym+xml" t535ball-Bundesliga dt. allg.">Fußball-Bun535be-inem-2Rüstung-4Rüstungref="http://de.wikiactu.com741"m+xml" tGa615twangenytFurtwangenrna>">/" e<' />> Freiburg im Üechtl399ibe-inem-2Ruth-4Ruthref="http://de.wikiactu.com741"m+xml" tGa8945isbre Politik">Gambisbre Politikrna>">/8945ie-inem-2Ruth Kelly-4Ruth Kellyref="http://de.wikiactu.com741"m+xml" tGa9023isbre Politik">Gambisbre Politikrna>">/9023ie-inem-2Ruth Maria Kubitsytek-4Ruth Maria Kubitsytekref="http://de.wikiactu.com741"m+xml" tGa94iermittelhersteller">Futtermittelherstel94iee-inem-2Ruud Lubbers-4Ruud Lubbersref="http://de.wikiactu.com741"m+xml" tGa902ball-Bundesliga dt. allg.">Fußball-Bun9025ie-inem-2Ruud van Nistelrooy-4Ruud van Nistelrooyref="http://de.wikiactu.com741"m+xml" tGa2105isbre Politik">Gambisbre Politikrna>">/2105ie-inem-2RWE-4RWEhref="http://de.wikiactu.com4871ym+xml" t70bisbre Politik">Gambisbre Politikrna>">/70bie-inem-2RWI-4RWIref="http://de.wikiactu.com741"m+xml" tGa1383isbre Politik">Gambisbre Politikrna>">/1383ee-inem-2Ryanair-4Ryanairhref="http://de.wikiactu.com4871ym+xml" t5858ball-2.Bundesliga dt. (Spielbericht)ytF5858be-inem-2Rye (New York)-4Rye (New York)ref="http://de.wikiactu.com741"m+xml" tGa425isbre Politik">Gambisbre Politikrna>">/4245ie-inem-2RZB-4RZBref="http://de.wikiactu.com741"m+xml" tGa144iburg im Üechtland">Freiburg im Üechtl144ibe-inem-2S-Bahn-4S-Bahnhref="http://de.wikiactu.com4871ym+xml" t761un Politik">Gabun Politikrna>">/" e<' />761une-inem-2Sa Nur-4Sa Nurref="http://de.wikiactu.com741"m+xml" tGa606ileo Galilei">Galileo Galileirna>">/" e<606ile-inem-2Saab-4Saabref="http://de.wikiactu.com741"m+xml" tGa7427isbre Politik">Gambisbre Politikrna>">/7427ie-inem-2Saab Automobile-4Saab Automobilehref="http://de.wikiactu.com4871ym+xml" t7030n Politik">Gabun Politikrna>">/" e<' />7030ne-inem-2Saad al-Hariri-4Saad al-Haririref="http://de.wikiactu.com741"m+xml" tGa68ileo Galilei">Galileo Galileirna>">/" e<68ile-inem-2SAAIDS-4SAAIDSref="http://de.wikiactu.com741"m+xml" tGa9057isbre Politik">Gambisbre Politikrna>">/9057ie-inem-2Saal a.d. Saale-4Saal a.d. Saalehref="http://de.wikiactu.com4871ym+xml" t5778isbre Politik">Gambisbre Politikrna>">/5778ie-inem-2Saale-Holzland-Kreis-4Saale-Holzland-Kreisref="http://de.wikiactu.com741"m+xml" tGa1508isbre Politik">Gambisbre Politikrna>">/1508ie-inem-2Saanen-4Saanenref="http://de.wikiactu.com741"m+xml" tGa923isbre Politik">Gambisbre Politikrna>">/923ie-inem-2Saarbrücken-4Saarbrückenref="http://de.wikiactu.com741"m+xml" tGa8378isbre Politik">Gambisbre Politikrna>">/8378ie-inem-2Saarbrücken (regional)-4Saarbrücken (regional)ref="http://de.wikiactu.com741"m+xml" tGa817ileo Galilei">Galileo Galileirna>">/" e<8179ie-inem-2Saarburg-4Saarburgref="http://de.wikiactu.com741"m+xml" tGa8225isbre Politik">Gambisbre Politikrna>">/8225ie-inem-2SAARC-4SAARCref="http://de.wikiactu.com741"m+xml" tGa837ileo Galilei">Galileo Galileirna>">/" e<8379ie-inem-2Saarländisytes Oberlandesgericht-4Saarländisytes Oberlandesgerichtref="http://de.wikiactu.com741"m+xml" tGa593ermittelhersteller">Futtermittelherstel593ee-inem-2Saarlouis-4Saarlouishref="http://de.wikiactu.com4871ym+xml" t3475isbre Politik">Gambisbre Politikrna>">/3475ie-inem-2Saarwellingen-4Saarwellingenref="http://de.wikiactu.com741"m+xml" tGa811ball-Bundesliga dt. allg.">Fußball-Bun811be-inem-2Sabah al-Ahmad al-Dsytabir as-Sabah-4Sabah al-Ahmad al-Dsytabir as-Sabahref="http://de.wikiactu.com741"m+xml" tGa139iburg im Üechtland">Freiburg im Üechtl139ibe-inem-2Sabena-4Sabenahref="http://de.wikiactu.com4871ym+xml" t9680n Politik">Gabun Politikrna>">/" e<' />9680ne-inem-2Sabine Bergmann-Potl-4Sabine Bergmann-Potlref="http://de.wikiactu.com741"m+xml" tGa436ileo Galilei">Galileo Galileirna>">/" e<436ile-inem-2Sabine Christiansen-4Sabine Christiansenref="http://de.wikiactu.com741"m+xml" tGa133ball-Bundesliga dt. allg.">Fußball-Bun1335le-inem-2Sabine Leutheusser-Schnarrenberger-4Sabine Leutheusser-Schnarrenbergerhref="http://de.wikiactu.com4871ym+xml" t693ileo Galilei">Galileo Galileirna>">/" e<693ile-inem-2Sabotage-4Sabotageref="http://de.wikiactu.com741"m+xml" tGa257bisbre Politik">Gambisbre Politikrna>">/257bie-inem-2Sacharowpreis-4Sacharowpreishref="http://de.wikiactu.com4871ym+xml" t301ball-Bundesliga dt. allg.">Fußball-Bun301be-inem-2Sachbeschädigung-4Sachbeschädigungref="http://de.wikiactu.com741"m+xml" tGa290ileo Galilei">Galileo Galileirna>">/" e<290ile-inem-2Sachbuch-4Sachbuchref="http://de.wikiactu.com741"m+xml" tGa2561isbre Politik">Gambisbre Politikrna>">/2561ie-inem-2Sachbuch allg.-4Sachbuch allg.href="http://de.wikiactu.com4871ym+xml" t69dez">Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />421ale-inem-2Sächsisytes Landesarbeitsgericht-4Sächsisytes Landesarbeitsgerichthref="http://de.wikiactu.com4871ym+xml" t7850l Mubarak">Gamal Mubarakrna>">/" e<' />7850le-inem-2Sacra Corona Unita-4Sacra Corona Unitaref="http://de.wikiactu.com741"m+xml" tGa157bisbre Politik">Gambisbre Politikrna>">/157bie-inem-2Sacramento-4Sacramentoref="http://de.wikiactu.com741"m+xml" tGa55a1isbre Politik">Gambisbre Politikrna>">/55a1ie-inem-2Sadakazu Tanigaki-4Sadakazu Tanigakiref="http://de.wikiactu.com741"m+xml" tGa105al Mubarak">Gamal Mubarakrna>">/" e<' />105ale-inem-2Saddam Hussein-4Saddam Husseinhref="http://de.wikiactu.com4871ym+xml" t397ermittelhersteller">Futtermittelherstel397ee-inem-2Saha Airlines-4Saha Airlinesref="http://de.wikiactu.com741"m+xml" tGa2261isbre Politik">Gambisbre Politikrna>">/2261ie-inem-2Sahedan-4Sahedanref="http://de.wikiactu.com741"m+xml" tGa808ermittelhersteller">Futtermittelherstel8084ne-inem-2SAIC-4SAICref="http://de.wikiactu.com741"m+xml" tGa720ermittelhersteller">Futtermittelherstel720ee-inem-2Saif al-Islam al-Gaddafi-4Saif al-Islam al-Gaddafihref="http://de.wikiactu.com4871ym+xml" t649twangenytFurtwangenrna>">/" e<' />> Gambisbre Politikrna>">/798twe-inem-2Saint Helier-4Saint Helierref="http://de.wikiactu.com741"m+xml" tGa803ermittelhersteller">Futtermittelherstel803ee-inem-2Saint John's-4Saint John'sref="http://de.wikiactu.com741"m+xml" tGa898ermittelhersteller">Futtermittelherstel898ee-inem-2Saint John's (Kanada)-4Saint John's (Kanada)ref="http://de.wikiactu.com741"m+xml" tGa494iburg im Üechtland">Freiburg im Üechtl494ibe-inem-2Saint Marie-4Saint Marieref="http://de.wikiactu.com741"m+xml" tGa220bisbre Politik">Gambisbre Politikrna>">/220bie-inem-2Saint Petersburg-4Saint Petersburghref="http://de.wikiactu.com4871ym+xml" t1157isbre Politik">Gambisbre Politikrna>">/1157ie-inem-2Saint-Denis (Réunion)-4Saint-Denis (Réunion)ref="http://de.wikiactu.com741"m+xml" tGa2670n Politik">Gabun Politikrna>">/" e<' />2670ie-inem-2Saint-Étienne (Loire)-4Saint-Étienne (Loire)ref="http://de.wikiactu.com741"m+xml" tGa494al Mubarak">Gamal Mubarakrna>">/" e<' />4943ie-inem-2Saint-Gilles-4Saint-Gilleshref="http://de.wikiactu.com4871ym+xml" t885ball-Bundesliga dt. allg.">Fußball-Bun8855ie-inem-2Saint-Imier-4Saint-Imierref="http://de.wikiactu.com741"m+xml" tGa442un Politik">Gabun Politikrna>">/" e<' />4421ie-inem-2Saint-Lary-Soulan-4Saint-Lary-Soulanref="http://de.wikiactu.com741"m+xml" tGa983ileo Galilei">Galileo Galileirna>">/" e<983ile-inem-2Saint-Paul-4Saint-Paulhref="http://de.wikiactu.com4871ym+xml" t368ball-Bundesliga dt. allg.">Fußball-Bun368be-inem-2Saint-Paul-lès-Durance-4Saint-Paul-lès-Durancehref="http://de.wikiactu.com4871ym+xml" t876al Mubarak">Gamal Mubarakrna>">/" e<' />876ale-inem-2Sajjed Barakah-4Sajjed Barakahref="http://de.wikiactu.com741"m+xml" tGa400ileo Galilei">Galileo Galileirna>">/" e<400ile-inem-2Sakhir-4Sakhirhref="http://de.wikiactu.com4871ym+xml" t782un Politik">Gabun Politikrna>">/" e<' />782une-inem-2Sakineh Mohammadi Ashtiani-4Sakineh Mohammadi Ashtianiref="http://de.wikiactu.com741"m+xml" tGa465iburg im Üechtland">Freiburg im Üechtl465ibe-inem-2Sal (Kap Verde)-4Sal (Kap Verde)ref="http://de.wikiactu.com741"m+xml" tGa685ermittelhersteller">Futtermittelherstel685ee-inem-2Sal.Oppenheim-4Sal.Oppenheimref="http://de.wikiactu.com741"m+xml" tGa638ball-Bundesliga dt. allg.">Fußball-Bun638be-inem-2Salafismus-4Salafismushref="http://de.wikiactu.com4871ym+xml" t8878isbre Politik">Gambisbre Politikrna>">/8878ie-inem-2Salam Fayyad-4Salam Fayyadhref="http://de.wikiactu.com4871ym+xml" t850iburg im Üechtland">Freiburg im Üechtl850ibe-inem-2Salem-4Salemref="http://de.wikiactu.com741"m+xml" tGa696iburg im Üechtland">Freiburg im Üechtl696ibe-inem-2Sali Berisha-4Sali Berisharef="http://de.wikiactu.com741"m+xml" tGa894iburg im Üechtland">Freiburg im Üechtl894ibe-inem-2Salisbury-4Salisburyref="http://de.wikiactu.com741"m+xml" tGa944un Politik">Gabun Politikrna>">/" e<' />944une-inem-2Sallanytes-4Sallanytesref="http://de.wikiactu.com741"m+xml" tGa92ddez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/18ie-inem-2Salman Rushdie-4Salman Rushdieref="http://de.wikiactu.com741"m+xml" tGa982ermittelhersteller">Futtermittelherstel982ee-inem-2Salmon-4Salmonhref="http://de.wikiactu.com4871ym+xml" t692dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/6307ie-inem-2Salt Lake City-4Salt Lake Cityhref="http://de.wikiactu.com4871ym+xml" t716iburg im Üechtland">Freiburg im Üechtl716ibe-inem-2Salvador Allende-4Salvador Allendehref="http://de.wikiactu.com4871ym+xml" t575iburg im Üechtland">Freiburg im Üechtl575ibe-inem-2Salvador da Bahía-4Salvador da Bahíaref="http://de.wikiactu.com741"m+xml" tGa809ileo Galilei">Galileo Galileirna>">/" e<809ile-inem-2Salvadorianisyte Politik-4Salvadorianisyte Politikref="http://de.wikiactu.com741"m+xml" tGa63iburg im Üechtland">Freiburg im Üechtl63ibe-inem-2Salzburg-4Salzburgref="http://de.wikiactu.com741"m+xml" tGa905isbre Politik">Gambisbre Politikrna>">/905be-inem-2Salzburg (regional)-4Salzburg (regional)ref="http://de.wikiactu.com741"m+xml" tGa83ball-Bundesliga dt. allg.">Fußball-Bun835be-inem-2Salzgitter-4Salzgitterref="http://de.wikiactu.com741"m+xml" tGa953al Mubarak">Gamal Mubarakrna>">/" e<' />953ale-inem-2Sam Bodman-4Sam Bodmanref="http://de.wikiactu.com741"m+xml" tGa208ermittelhersteller">Futtermittelherstel2084ne-inem-2Sam Sullivan-4Sam Sullivanhref="http://de.wikiactu.com4871ym+xml" t5361isbre Politik">Gambisbre Politikrna>">/5361ie-inem-2Samak Sundaravej-4Samak Sundaravejref="http://de.wikiactu.com741"m+xml" tGa477ermittelhersteller">Futtermittelherstel477ee-inem-2Samara-4Samarahref="http://de.wikiactu.com4871ym+xml" t781un Politik">Gabun Politikrna>">/" e<' />7811ie-inem-2Samarra-4Samarrahref="http://de.wikiactu.com4871ym+xml" t907dez">Gardezrna>">/" e<' />>
Futtermittelherstel921ee-inem-2Same-4Samehref="http://de.wikiactu.com4871ym+xml" t761bisbre Politik">Gambisbre Politikrna>">/7617ee-inem-2Samedan-4Samedanref="http://de.wikiactu.com741"m+xml" tGa720al Mubarak">Gamal Mubarakrna>">/" e<' />720ale-inem-2Samir Rifai-4Samir Rifaihref="http://de.wikiactu.com4871ym+xml" t882twangenytFurtwangenrna>">/" e<' />> Gabun Politikrna>">/" e<' />728une-inem-2Samsung-4Samsungref="http://de.wikiactu.com741"m+xml" tGa673tball-2.Bundesliga dt. (Spielbericht)ytF673tbe-inem-2Samut Sakhon-4Samut Sakhonhref="http://de.wikiactu.com4871ym+xml" t846twangenytFurtwangenrna>">/" e<' />> Futtermittelherstel434ee-inem-2San Bernardino-4San Bernardinoref="http://de.wikiactu.com741"m+xml" tGa730ermittelhersteller">Futtermittelherstel730ee-inem-2San Carlos-4San Carloshref="http://de.wikiactu.com4871ym+xml" t3410n Politik">Gabun Politikrna>">/" e<' />3410ne-inem-2San Carlos (Kalifornien)-4San Carlos (Kalifornien)href="http://de.wikiactu.com4871ym+xml" t304twangenytFurtwangenrna>">/" e<' />> Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/2307ie-inem-2San José-4San Joséhref="http://de.wikiactu.com4871ym+xml" t317un Politik">Gabun Politikrna>">/" e<' />317une-inem-2San José (Kalifornien)-4San José (Kalifornien)href="http://de.wikiactu.com4871ym+xml" t348ileo Galilei">Galileo Galileirna>">/" e<348ile-inem-2San Juan de Grijalva-4San Juan de Grijalvahref="http://de.wikiactu.com4871ym+xml" t9080n Politik">Gabun Politikrna>">/" e<' />9080ne-inem-2San Marino (Stadt)-4San Marino (Stadt)ref="http://de.wikiactu.com741"m+xml" tGa6291isbre Politik">Gambisbre Politikrna>">/6291ie-inem-2San Salvador-4San Salvadorref="http://de.wikiactu.com741"m+xml" tGa956twangenytFurtwangenrna>">/" e<' />> Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />25ale-inem-2Sanaa-4Sanaahref="http://de.wikiactu.com4871ym+xml" t903dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />908une-inem-2Sand in Taufers-4Sand in Taufersref="http://de.wikiactu.com741"m+xml" tGa614ileo Galilei">Galileo Galileirna>">/" e<614ile-inem-2Sandra Bullock-4Sandra Bullockhref="http://de.wikiactu.com4871ym+xml" t640al Mubarak">Gamal Mubarakrna>">/" e<' />640ale-inem-2Sandrakaty-4Sandrakatyref="http://de.wikiactu.com741"m+xml" tGa557ileo Galilei">Galileo Galileirna>">/" e<557ile-inem-2Sandvika-4Sandvikaref="http://de.wikiactu.com741"m+xml" tGa146ermittelhersteller">Futtermittelherstel146ee-inem-2Sänger-4Sängerhref="http://de.wikiactu.com4871ym+xml" t3057isbre Politik">Gambisbre Politikrna>">/3057ie-inem-2Sänger allg.-4Sänger allg.href="http://de.wikiactu.com4871ym+xml" t17i0n Politik">Gabun Politikrna>">/" e<' />17i0ne-inem-2Sangerhausen-4Sangerhausenref="http://de.wikiactu.com741"m+xml" tGa427ermittelhersteller">Futtermittelherstel427ee-inem-2Sankt Georgen an der Stiefing-4Sankt Georgen an der Stiefingref="http://de.wikiactu.com741"m+xml" tGa92dtwangenytFurtwangenrna>">/" e<' />> Freiburg im Üechtl178ibe-inem-2Sankt Petersburg-4Sankt Petersburgref="http://de.wikiactu.com741"m+xml" tGa445ball-Bundesliga dt. allg.">Fußball-Bun445be-inem-2Sankt Veit an der Glan-4Sankt Veit an der Glanhref="http://de.wikiactu.com4871ym+xml" t5700n Politik">Gabun Politikrna>">/" e<' />5700ne-inem-2Sanktionsrecht-4Sanktionsrechtref="http://de.wikiactu.com741"m+xml" tGa487al Mubarak">Gamal Mubarakrna>">/" e<' />48b3ie-inem-2Şanlıurfa-4Şanlıurfaref="http://de.wikiactu.com741"m+xml" tGa5597isbre Politik">Gambisbre Politikrna>">/5597ie-inem-2Sanlu-4Sanluhref="http://de.wikiactu.com4871ym+xml" t686ermittelhersteller">Futtermittelherstel686ee-inem-2Sanremo-4Sanremohref="http://de.wikiactu.com4871ym+xml" t659al Mubarak">Gamal Mubarakrna>">/" e<' />659ale-inem-2Sansibar-4Sansibarref="http://de.wikiactu.com741"m+xml" tGa678ermittelhersteller">Futtermittelherstel678ee-inem-2Sanski Most-4Sanski Mosthref="http://de.wikiactu.com4871ym+xml" t845iburg im Üechtland">Freiburg im Üechtl845ibe-inem-2Santa Ana-4Santa Anaref="http://de.wikiactu.com741"m+xml" tGa431ball-Bundesliga dt. allg.">Fußball-Bun431be-inem-2Santa Clara-4Santa Clarahref="http://de.wikiactu.com4871ym+xml" t873al Mubarak">Gamal Mubarakrna>">/" e<' />873ale-inem-2Santa Clara (Kalifornien)-4Santa Clara (Kalifornien)href="http://de.wikiactu.com4871ym+xml" t764al Mubarak">Gamal Mubarakrna>">/" e<' />764ale-inem-2Santa Fe (New Mexico)-4Santa Fe (New Mexico)href="http://de.wikiactu.com4871ym+xml" t58ddez">Gardezrna>">/" e<' />>
Galileo Galileirna>">/" e<731ile-inem-2Santa Marta-4Santa Martaref="http://de.wikiactu.com741"m+xml" tGa5257isbre Politik">Gambisbre Politikrna>">/5257ie-inem-2Santa Rosa (Kalifornien)-4Santa Rosa (Kalifornien)ref="http://de.wikiactu.com741"m+xml" tGa4837isbre Politik">Gambisbre Politikrna>">/4837ie-inem-2Santiago de Chile-4Santiago de Chilehref="http://de.wikiactu.com4871ym+xml" t9085isbre Politik">Gambisbre Politikrna>">/9085ie-inem-2Santiago de Compostela-4Santiago de Compostelahref="http://de.wikiactu.com4871ym+xml" t3188isbre Politik">Gambisbre Politikrna>">/318twe-inem-2Santillana del Mar-4Santillana del Marref="http://de.wikiactu.com741"m+xml" tGa14un Politik">Gabun Politikrna>">/" e<' />14une-inem-2Santo Domingo-4Santo Domingoref="http://de.wikiactu.com741"m+xml" tGa541un Politik">Gabun Politikrna>">/" e<' />541une-inem-2Santoña-4Santoñaref="http://de.wikiactu.com741"m+xml" tGa56ddez">Gardezrna>">/" e<' />>
Galileo Galileirna>">/" e<218ile-inem-2Sanya-4Sanyahref="http://de.wikiactu.com4871ym+xml" t109ileo Galilei">Galileo Galileirna>">/" e<109ile-inem-2São Paulo-4São Pauloref="http://de.wikiactu.com741"m+xml" tGa5567isbre Politik">Gambisbre Politikrna>">/556bie-inem-2SAP-4SAPhref="http://de.wikiactu.com4871ym+xml" t908dez">Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />395ale-inem-2Sapporo-4Sapporohref="http://de.wikiactu.com4871ym+xml" t181iburg im Üechtland">Freiburg im Üechtl181ibe-inem-2Saquarema-4Saquaremaref="http://de.wikiactu.com741"m+xml" tGa281ball-Bundesliga dt. allg.">Fußball-Bun281be-inem-2SAR-Lupe-4SAR-Luperef="http://de.wikiactu.com741"m+xml" tGa432iburg im Üechtland">Freiburg im Üechtl432ibe-inem-2Saragossa-4Saragossahref="http://de.wikiactu.com4871ym+xml" t851iburg im Üechtland">Freiburg im Üechtl851ibe-inem-2Sarah Connor-4Sarah Connorref="http://de.wikiactu.com741"m+xml" tGa546ileo Galilei">Galileo Galileirna>">/" e<546ile-inem-2Sarah Palin-4Sarah Palinref="http://de.wikiactu.com741"m+xml" tGa819al Mubarak">Gamal Mubarakrna>">/" e<' />819ale-inem-2Sarah Wagenknecht-4Sarah Wagenknechtref="http://de.wikiactu.com741"m+xml" tGa407dez">Gardezrna>">/" e<' />>
Freiburg im Üechtl279ibe-inem-2Sari Pul-4Sari Pulhref="http://de.wikiactu.com4871ym+xml" t798dez">Gardezrna>">/" e<' />>
Fußball-Bun736be-inem-2Sassnitz-4Sassnitzhref="http://de.wikiactu.com4871ym+xml" t337isbre Politik">Gambisbre Politikrna>">/337ie-inem-2Sat.1-4Sat.1href="http://de.wikiactu.com4871ym+xml" t938un Politik">Gabun Politikrna>">/" e<' />938une-inem-2Satellml"nfernsehen-4Satellml"nfernsehenhref="http://de.wikiactu.com4871ym+xml" t3495isbre Politik">Gambisbre Politikrna>">/3495ie-inem-2Satellml"nstartzentrum Taiyun-4Satellml"nstartzentrum Taiyunhref="http://de.wikiactu.com4871ym+xml" t325isbre Politik">Gambisbre Politikrna>">/325ie-inem-2Satire-4Satireref="http://de.wikiactu.com741"m+xml" tGa592iburg im Üechtland">Freiburg im Üechtl592ibe-inem-2Saturn-4Saturnref="http://de.wikiactu.com741"m+xml" tGa873un Politik">Gabun Politikrna>">/" e<' />87a1ie-inem-2Saturn (Automarke)-4Saturn (Automarke)href="http://de.wikiactu.com4871ym+xml" t304al Mubarak">Gamal Mubarakrna>">/" e<' />304ale-inem-2Saturnmission-4Saturnmissionref="http://de.wikiactu.com741"m+xml" tGa870ileo Galilei">Galileo Galileirna>">/" e<870ile-inem-2Saudi-Arabien-4Saudi-Arabienhref="http://de.wikiactu.com4871ym+xml" t651ermittelhersteller">Futtermittelherstel651ee-inem-2Saudi-arabisyte Personalie-4Saudi-arabisyte Personaliehref="http://de.wikiactu.com4871ym+xml" t7130n Politik">Gabun Politikrna>">/" e<' />7130ne-inem-2Sauerlach-4Sauerlachref="http://de.wikiactu.com741"m+xml" tGa9850l Mubarak">Gamal Mubarakrna>">/" e<' />9850le-inem-2Savona-4Savonaref="http://de.wikiactu.com741"m+xml" tGa713un Politik">Gabun Politikrna>">/" e<' />713une-inem-2Sayeeda Warsi-4Sayeeda Warsiref="http://de.wikiactu.com741"m+xml" tGa1505isbre Politik">Gambisbre Politikrna>">/1505ie-inem-2SC Fortuna Köln-4SC Fortuna Kölnref="http://de.wikiactu.com741"m+xml" tGa254bisbre Politik">Gambisbre Politikrna>">/254bie-inem-2SC Freiburg-4SC Freiburgref="http://de.wikiactu.com741"m+xml" tGa2351isbre Politik">Gambisbre Politikrna>">/2351ie-inem-2SC Magdeburg-4SC Magdeburgref="http://de.wikiactu.com741"m+xml" tGa9105isbre Politik">Gambisbre Politikrna>">/9105ie-inem-2SC Paderborn 07isSC Paderborn 07ref="http://de.wikiactu.com741"m+xml" tGa976iburg im Üechtland">Freiburg im Üechtl976ibe-inem-2Scandinavian Airlines-4Scandinavian Airlinesref="http://de.wikiactu.com741"m+xml" tGa290ermittelhersteller">Futtermittelherstel290ee-inem-2Schaan-4Schaanhref="http://de.wikiactu.com4871ym+xml" t383tball-2.Bundesliga dt. (Spielbericht)ytF383tbe-inem-2Schabwa-4Schabwahref="http://de.wikiactu.com4871ym+xml" t35al Mubarak">Gamal Mubarakrna>">/" e<' />35ale-inem-2Schach-4Schachref="http://de.wikiactu.com741"m+xml" tGa711al Mubarak">Gamal Mubarakrna>">/" e<' />711ale-inem-2Schacht Konrad-4Schacht Konradhref="http://de.wikiactu.com4871ym+xml" t699twangenytFurtwangenrna>">/" e<' />> Gardezrna>">/" e<' />>
Futtermittelherstel837ee-inem-2Schachtebich-4Schachtebichref="http://de.wikiactu.com741"m+xml" tGa153ball-Bundesliga dt. allg.">Fußball-Bun1535be-inem-2Schad"nsersatzrecht-4Schad"nsersatzrechtref="http://de.wikiactu.com741"m+xml" tGa4478isbre Politik">Gambisbre Politikrna>">/4478ie-inem-2Schädlingsbekämpfung-4Schädlingsbekämpfungref="http://de.wikiactu.com741"m+xml" tGa7200n Politik">Gabun Politikrna>">/" e<' />7200ne-inem-2Schaeffler-Gruppe-4Schaeffler-Gruppehref="http://de.wikiactu.com4871ym+xml" t101al Mubarak">Gamal Mubarakrna>">/" e<' />101ale-inem-2Schaf-4Schafref="http://de.wikiactu.com741"m+xml" tGa453ball-Bundesliga dt. allg.">Fußball-Bun4535be-inem-2Schaffhausen-4Schaffhausenref="http://de.wikiactu.com741"m+xml" tGa4537isbre Politik">Gambisbre Politikrna>">/4537ie-inem-2Schaffhausen (Kanton)-4Schaffhausen (Kanton)href="http://de.wikiactu.com4871ym+xml" t6525isbre Politik">Gambisbre Politikrna>">/6525ie-inem-2Schäftlarn-4Schäftlarnref="http://de.wikiactu.com741"m+xml" tGa977ermittelhersteller">Futtermittelherstel977ee-inem-2Schallod"nbach-4Schallod"nbachref="http://de.wikiactu.com741"m+xml" tGa801un Politik">Gabun Politikrna>">/" e<' />801une-inem-2Schangaösen-4Schangaösenref="http://de.wikiactu.com741"m+xml" tGa919al Mubarak">Gamal Mubarakrna>">/" e<' />919ale-inem-2Schänis-4Schänishref="http://de.wikiactu.com4871ym+xml" t656ileo Galilei">Galileo Galileirna>">/" e<656ile-inem-2Scharia-4Schariaref="http://de.wikiactu.com741"m+xml" tGa806iburg im Üechtland">Freiburg im Üechtl806ibe-inem-2Schas-4Schashref="http://de.wikiactu.com4871ym+xml" t689iburg im Üechtland">Freiburg im Üechtl689ibe-inem-2Schaul Mofaz-4Schaul Mofazref="http://de.wikiactu.com741"m+xml" tGa971iburg im Üechtland">Freiburg im Üechtl971ibe-inem-2Schauren-4Schaurenref="http://de.wikiactu.com741"m+xml" tGa154dez">Gardezrna>">/" e<' />>
Freiburg im Üechtl6656be-inem-2Scheidung-4Scheidungref="http://de.wikiactu.com741"m+xml" tGa274un Politik">Gabun Politikrna>">/" e<' />274une-inem-2Schenefeld (Kreis Pinneberg)-4Schenefeld (Kreis Pinneberg)ref="http://de.wikiactu.com741"m+xml" tGa4995isbre Politik">Gambisbre Politikrna>">/499be-inem-2Schengener Abkommen-4Schengener Abkommenref="http://de.wikiactu.com741"m+xml" tGa130un Politik">Gabun Politikrna>">/" e<' />130une-inem-2Schering-4Scheringref="http://de.wikiactu.com741"m+xml" tGa11aileo Galilei">Galileo Galileirna>">/" e<113ile-inem-2Schiedsrichter-4Schiedsrichterref="http://de.wikiactu.com741"m+xml" tGa127ileo Galilei">Galileo Galileirna>">/" e<127ile-inem-2Schienenfahrzeughersteller-4Schienenfahrzeugherstellerhref="http://de.wikiactu.com4871ym+xml" t848dez">Gardezrna>">/" e<' />>
Fußball-Bun305be-inem-2Schiffsbrand-4Schiffsbrandref="http://de.wikiactu.com741"m+xml" tGa218leo Galilei">Galileo Galileirna>">/" e<218be-inem-2Schiffsunfall-4Schiffsunfallhref="http://de.wikiactu.com4871ym+xml" t867iburg im Üechtland">Freiburg im Üechtl867ibe-inem-2Schiffsverkehr-4Schiffsverkehrhref="http://de.wikiactu.com4871ym+xml" t843iburg im Üechtland">Freiburg im Üechtl843ibe-inem-2Schildkröte-4Schildkröteref="http://de.wikiactu.com741"m+xml" tGa433al Mubarak">Gamal Mubarakrna>">/" e<' />433ale-inem-2Schimon Peres-4Schimon Peresref="http://de.wikiactu.com741"m+xml" tGa561ball-Bundesliga dt. allg.">Fußball-Bun561be-inem-2Schin Bet-4Schin Bethref="http://de.wikiactu.com4871ym+xml" t5318leo Galilei">Galileo Galileirna>">/" e<5318le-inem-2Schinderhannes-4Schinderhannesref="http://de.wikiactu.com741"m+xml" tGa2760n Politik">Gabun Politikrna>">/" e<' />2760ne-inem-2Schipkau-4Schipkauhref="http://de.wikiactu.com4871ym+xml" t761isbre Politik">Gambisbre Politikrna>">/761ne-inem-2Schlaganfall-4Schlaganfallhref="http://de.wikiactu.com4871ym+xml" t384ileo Galilei">Galileo Galileirna>">/" e<384ile-inem-2Schlägerei-4Schlägereiref="http://de.wikiactu.com741"m+xml" tGa294iburg im Üechtland">Freiburg im Üechtl294ibe-inem-2Schlagermusik-4Schlagermusikhref="http://de.wikiactu.com4871ym+xml" t3133isbre Politik">Gambisbre Politikrna>">/313ale-inem-2Schlange-4Schlangeref="http://de.wikiactu.com741"m+xml" tGa9550l Mubarak">Gamal Mubarakrna>">/" e<' />9550le-inem-2Schlangen-4Schlangenref="http://de.wikiactu.com741"m+xml" tGa70ileo Galilei">Galileo Galileirna>">/" e<70ile-inem-2Schlechtwetterlage-4Schlechtwetterlagehref="http://de.wikiactu.com4871ym+xml" t3900n Politik">Gabun Politikrna>">/" e<' />3900ne-inem-2Schlecker-4Schleckerref="http://de.wikiactu.com741"m+xml" tGa9620n Politik">Gabun Politikrna>">/" e<' />9620ne-inem-2Schleicher-4Schleicherhref="http://de.wikiactu.com4871ym+xml" t687ileo Galilei">Galileo Galileirna>">/" e<687ile-inem-2Schleichwerbung-4Schleichwerbungref="http://de.wikiactu.com741"m+xml" tGa9588isbre Politik">Gambisbre Politikrna>">/9588ie-inem-2Schleimhautentzündung-4Schleimhautentzündungref="http://de.wikiactu.com741"m+xml" tGa4505isbre Politik">Gambisbre Politikrna>">/4505ie-inem-2Schleswig-4Schleswighref="http://de.wikiactu.com4871ym+xml" t643dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/911bie-inem-2Schleswig-Holsteinisyter Landtag-4Schleswig-Holsteinisyter Landtaghref="http://de.wikiactu.com4871ym+xml" t659twangenytFurtwangenrna>">/" e<' />> Gambisbre Politikrna>">/130ale-inem-2Schliersee-4Schlierseeref="http://de.wikiactu.com741"m+xml" tGa242ermittelhersteller">Futtermittelherstel242ee-inem-2Schloß Holte-Stukenbrock-4Schloß Holte-Stukenbrockref="http://de.wikiactu.com741"m+xml" tGa912iburg im Üechtland">Freiburg im Üechtl912ibe-inem-2Schlüchtern-4Schlüchternref="http://de.wikiactu.com741"m+xml" tGa786iburg im Üechtland">Freiburg im Üechtl786ibe-inem-2Schlüsselbeinbruch-4Schlüsselbeinbruchhref="http://de.wikiactu.com4871ym+xml" t768ileo Galilei">Galileo Galileirna>">/" e<768ile-inem-2Schmallenberg-4Schmallenberghref="http://de.wikiactu.com4871ym+xml" t9058ball-2.Bundesliga dt. (Spielbericht)ytF9058be-inem-2Schmelz-4Schmelzref="http://de.wikiactu.com741"m+xml" tGa44d7isbre Politik">Gambisbre Politikrna>">/4467be-inem-2Schmerzensgeld-4Schmerzensgeldref="http://de.wikiactu.com741"m+xml" tGa152ileo Galilei">Galileo Galileirna>">/" e<152ile-inem-2Schmuggel-4Schmuggelref="http://de.wikiactu.com741"m+xml" tGa224un Politik">Gabun Politikrna>">/" e<' />224une-inem-2Schnee-4Schneeref="http://de.wikiactu.com741"m+xml" tGa8427isbre Politik">Gambisbre Politikrna>">/8427ie-inem-2Schneeberg-4Schneebergref="http://de.wikiactu.com741"m+xml" tGa676iburg im Üechtland">Freiburg im Üechtl676ibe-inem-2Schneesturm-4Schneesturmref="http://de.wikiactu.com741"m+xml" tGa205ileo Galilei">Galileo Galileirna>">/" e<205ile-inem-2Schockzustand-4Schockzustandhref="http://de.wikiactu.com4871ym+xml" t867ileo Galilei">Galileo Galileirna>">/" e<867ile-inem-2Schollach-4Schollachref="http://de.wikiactu.com741"m+xml" tGa984al Mubarak">Gamal Mubarakrna>">/" e<' />984ale-inem-2Schonach-4Schonachref="http://de.wikiactu.com741"m+xml" tGa185isbre Politik">Gambisbre Politikrna>">/185ie-inem-2Schönefeld (bei Berlin)-4Schönefeld (bei Berlin)ref="http://de.wikiactu.com741"m+xml" tGa292ileo Galilei">Galileo Galileirna>">/" e<292ile-inem-2Schönenberg-Kübelberg-4Schönenberg-Kübelbergref="http://de.wikiactu.com741"m+xml" tGa837ball-Bundesliga dt. allg.">Fußball-Bun8375ie-inem-2Schönheitswettbewerb-4Schönheitswettbewerbhref="http://de.wikiactu.com4871ym+xml" t66dtwangenytFurtwangenrna>">/" e<' />> Gambisbre Politikrna>">/634bie-inem-2Schopp-4Schoppref="http://de.wikiactu.com741"m+xml" tGa976bisbre Politik">Gambisbre Politikrna>">/9767be-inem-2Schriftart-4Schriftarthref="http://de.wikiactu.com4871ym+xml" t516ermittelhersteller">Futtermittelherstel516ee-inem-2Schriftsteller allg.-4Schriftsteller allg.href="http://de.wikiactu.com4871ym+xml" t650ermittelhersteller">Futtermittelherstel650ee-inem-2Schufa-4Schufaref="http://de.wikiactu.com741"m+xml" tGa2778isbre Politik">Gambisbre Politikrna>">/2778ie-inem-2Schuhindustrie-4Schuhindustriehref="http://de.wikiactu.com4871ym+xml" t9350l Mubarak">Gamal Mubarakrna>">/" e<' />9350le-inem-2Schule-4Schulehref="http://de.wikiactu.com4871ym+xml" t28un Politik">Gabun Politikrna>">/" e<' />28une-inem-2Schule allg.-4Schule allg.href="http://de.wikiactu.com4871ym+xml" t92twangenytFurtwangenrna>">/" e<' />> Gardezrna>">/" e<' />>
Fußball-Bun916be-inem-2Schulunfall-4Schulunfallhref="http://de.wikiactu.com4871ym+xml" t92ermittelhersteller">Futtermittelherstel92ee-inem-2Schulwesen-4Schulwesenref="http://de.wikiactu.com741"m+xml" tGa275iburg im Üechtland">Freiburg im Üechtl275ibe-inem-2Schüttorf-4Schüttorfref="http://de.wikiactu.com741"m+xml" tGa1223isbre Politik">Gambisbre Politikrna>">/1223ie-inem-2Schwäbisyt Hall-4Schwäbisyt Hallhref="http://de.wikiactu.com4871ym+xml" t287dez">Gardezrna>">/" e<' />>
Galileo Galileirna>">/" e<496ile-inem-2Schwalbe-4Schwalbehref="http://de.wikiactu.com4871ym+xml" t573ball-Bundesliga dt. allg.">Fußball-Bun573be-inem-2Schwalmtal (Niederrhein)-4Schwalmtal (Niederrhein)href="http://de.wikiactu.com4871ym+xml" t660ermittelhersteller">Futtermittelherstel660ee-inem-2Schwandorf-4Schwandorfref="http://de.wikiactu.com741"m+xml" tGa713ileo Galilei">Galileo Galileirna>">/" e<713ile-inem-2Schwangau-4Schwangauhref="http://de.wikiactu.com4871ym+xml" t24iermittelhersteller">Futtermittelherstel24iee-inem-2Schwarzbuch-4Schwarzbuchhref="http://de.wikiactu.com4871ym+xml" t330ermittelhersteller">Futtermittelherstel330ee-inem-2Schwarzwild-4Schwarzwildref="http://de.wikiactu.com741"m+xml" tGa8200n Politik">Gabun Politikrna>">/" e<' />8200ne-inem-2Schwedisyte Akademie der Wissenschaften-4Schwedisyte Akademie der Wissenschaftenref="http://de.wikiactu.com741"m+xml" tGa272ileo Galilei">Galileo Galileirna>">/" e<272ile-inem-2Schwedisyte Fußballnationalmannschaft-4Schwedisyte Fußballnationalmannschaftref="http://de.wikiactu.com741"m+xml" tGa495iburg im Üechtland">Freiburg im Üechtl495ibe-inem-2Schwedisyte Personalie-4Schwedisyte Personalieref="http://de.wikiactu.com741"m+xml" tGa4270n Politik">Gabun Politikrna>">/" e<' />4270ne-inem-2Schweich-4Schweichref="http://de.wikiactu.com741"m+xml" tGa461iburg im Üechtland">Freiburg im Üechtl461ibe-inem-2Schwein-4Schweinref="http://de.wikiactu.com741"m+xml" tGa462dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/896bie-inem-2Schweizer Armee-4Schweizer Armeehref="http://de.wikiactu.com4871ym+xml" t302ileo Galilei">Galileo Galileirna>">/" e<302ile-inem-2Schweizer Außenpolitik-4Schweizer Außenpolitikref="http://de.wikiactu.com741"m+xml" tGa550ileo Galilei">Galileo Galileirna>">/" e<550ile-inem-2Schweizer Fernsehen-4Schweizer Fernsehenref="http://de.wikiactu.com741"m+xml" tGa415ermittelhersteller">Futtermittelherstel415ee-inem-2Schweizer Fußballnationalmannschaft-4Schweizer Fußballnationalmannschaftref="http://de.wikiactu.com741"m+xml" tGa239iburg im Üechtland">Freiburg im Üechtl239ibe-inem-2Schweizer Gerichtsbarkeit-4Schweizer Gerichtsbarkeitref="http://de.wikiactu.com741"m+xml" tGa495al Mubarak">Gamal Mubarakrna>">/" e<' />495ale-inem-2Schweizer Personalie-4Schweizer Personalieref="http://de.wikiactu.com741"m+xml" tGa831un Politik">Gabun Politikrna>">/" e<' />831une-inem-2Schweizer Wirtschaft-4Schweizer Wirtschaftref="http://de.wikiactu.com741"m+xml" tGa423al Mubarak">Gamal Mubarakrna>">/" e<' />423ale-inem-2Schweizergarde-4Schweizergardehref="http://de.wikiactu.com4871ym+xml" t904ermittelhersteller">Futtermittelherstel904ee-inem-2Schweizerisyte Bundesbahn-4Schweizerisyte Bundesbahnref="http://de.wikiactu.com741"m+xml" tGa21ddez">Gardezrna>">/" e<' />>
">/" e<' />> Gamal Mubarakrna>">/" e<' />676ale-inem-2Schwere Körperverletzung-4Schwere Körperverletzunghref="http://de.wikiactu.com4871ym+xml" t640dez">Gardezrna>">/" e<' />>
Freiburg im Üechtl438ibe-inem-2Schwerin-4Schwerinhref="http://de.wikiactu.com4871ym+xml" t3307isbre Politik">Gambisbre Politikrna>">/3307ie-inem-2Schwerin (regional)-4Schwerin (regional)ref="http://de.wikiactu.com741"m+xml" tGa714ileo Galilei">Galileo Galileirna>">/" e<714ile-inem-2Schwimm-WM 2005-4Schwimm-WM 2005ref="http://de.wikiactu.com741"m+xml" tGa870ermittelhersteller">Futtermittelherstel870ee-inem-2Schwimmbad-4Schwimmbadref="http://de.wikiactu.com741"m+xml" tGa480twangenytFurtwangenrna>">/" e<' />> Freiburg im Üechtl952ibe-inem-2Schwimmer-4Schwimmerhref="http://de.wikiactu.com4871ym+xml" t360dez">Gardezrna>">/" e<' />>
Freiburg im Üechtl225ibe-inem-2Science-Fiction-4Science-Fictionref="http://de.wikiactu.com741"m+xml" tGa568ermittelhersteller">Futtermittelherstel568ee-inem-2Scientology-4Scientologyhref="http://de.wikiactu.com4871ym+xml" t601ileo Galilei">Galileo Galileirna>">/" e<601ile-inem-2Scott Brown-4Scott Brownref="http://de.wikiactu.com741"m+xml" tGa674bisbre Politik">Gambisbre Politikrna>">/674bie-inem-2Scottsdale-4Scottsdalehref="http://de.wikiactu.com4871ym+xml" t930dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/3883ie-inem-2SdK-4SdKref="http://de.wikiactu.com741"m+xml" tGa8951isbre Politik">Gambisbre Politikrna>">/8951ie-inem-2SDKÚ-DS-4SDKÚ-DShref="http://de.wikiactu.com4871ym+xml" t9091isbre Politik">Gambisbre Politikrna>">/9091ie-inem-2Sea Launch-4Sea Launchref="http://de.wikiactu.com741"m+xml" tGa916twangenytFurtwangenrna>">/" e<' />> Gambisbre Politikrna>">/8583ie-inem-2Sean O'Keefe-4Sean O'Keeferef="http://de.wikiactu.com741"m+xml" tGa158ermittelhersteller">Futtermittelherstel158ee-inem-2Seattle-4Seattleref="http://de.wikiactu.com741"m+xml" tGa916ileo Galilei">Galileo Galileirna>">/" e<916ile-inem-2Sebastian Deisler-4Sebastian Deislerref="http://de.wikiactu.com741"m+xml" tGa5iermittelhersteller">Futtermittelherstel5iee-inem-2Sebastian Edathy-4Sebastian Edathyref="http://de.wikiactu.com741"m+xml" tGa712ileo Galilei">Galileo Galileirna>">/" e<712ile-inem-2Sebastian Frankenberger-4Sebastian Frankenbergerref="http://de.wikiactu.com741"m+xml" tGa123iburg im Üechtland">Freiburg im Üechtl123ibe-inem-2Sebastian Kehl-4Sebastian Kehlhref="http://de.wikiactu.com4871ym+xml" t601ermittelhersteller">Futtermittelherstel601ee-inem-2Sebastián Piñera-4Sebastián Piñerahref="http://de.wikiactu.com4871ym+xml" t5395isbre Politik">Gambisbre Politikrna>">/5395ie-inem-2Sebastian Vettel-4Sebastian Vettelhref="http://de.wikiactu.com4871ym+xml" t510n Politik">Gabun Politikrna>">/" e<' />510ne-inem-2SEC-4SECref="http://de.wikiactu.com741"m+xml" tGa804un Politik">Gabun Politikrna>">/" e<' />804une-inem-2Second Life-4Second Lifehref="http://de.wikiactu.com4871ym+xml" t583ermittelhersteller">Futtermittelherstel583ee-inem-2Seeland (Sachsen-Anhalt)-4Seeland (Sachsen-Anhalt)href="http://de.wikiactu.com4871ym+xml" t900ermittelhersteller">Futtermittelherstel900ee-inem-2Seerecht-4Seerechthref="http://de.wikiactu.com4871ym+xml" t6807isbre Politik">Gambisbre Politikrna>">/6807ie-inem-2Segelflugzeug allg.-4Segelflugzeug allg.href="http://de.wikiactu.com4871ym+xml" t935ball-Bundesliga dt. allg.">Fußball-Bun935be-inem-2Segeln-4Segelnhref="http://de.wikiactu.com4871ym+xml" t334ball-Bundesliga dt. allg.">Fußball-Bun334be-inem-2Ségolène Royal-4Ségolène Royalhref="http://de.wikiactu.com4871ym+xml" t513isbre Politik">Gambisbre Politikrna>">/51ale-inem-2Seilbahnbetreiber-4Seilbahnbetreiberref="http://de.wikiactu.com741"m+xml" tGa7710n Politik">Gabun Politikrna>">/" e<' />7710ne-inem-2Seilbahnverkehr-4Seilbahnverkehrhref="http://de.wikiactu.com4871ym+xml" t327ileo Galilei">Galileo Galileirna>">/" e<327ile-inem-2Selenia-4Seleniaref="http://de.wikiactu.com741"m+xml" tGa4195isbre Politik">Gambisbre Politikrna>">/4195ie-inem-2Selig"nstadt-4Selig"nstadthref="http://de.wikiactu.com4871ym+xml" t921un Politik">Gabun Politikrna>">/" e<' />921une-inem-2Sellapan Rama Nathan-4Sellapan Rama Nathanref="http://de.wikiactu.com741"m+xml" tGa726ermittelhersteller">Futtermittelherstel726ee-inem-2Sendai-4Sendairef="http://de.wikiactu.com741"m+xml" tGa7357isbre Politik">Gambisbre Politikrna>">/7357ie-inem-2Senden-4Sendenref="http://de.wikiactu.com741"m+xml" tGa9191isbre Politik">Gambisbre Politikrna>">/9191ie-inem-2Senegalesisyte Fußballnationalmannschaft-4Senegalesisyte Fußballnationalmannschaftref="http://de.wikiactu.com741"m+xml" tGa945ermittelhersteller">Futtermittelherstel945ee-inem-2Senegalesisyte Politik-4Senegalesisyte Politikhref="http://de.wikiactu.com4871ym+xml" t904iburg im Üechtland">Freiburg im Üechtl904ibe-inem-2Seniorenmanagement-4Seniorenmanagementref="http://de.wikiactu.com741"m+xml" tGa9651isbre Politik">Gambisbre Politikrna>">/9651ie-inem-2Sensors Unlim" td-4Sensors Unlim" tdref="http://de.wikiactu.com741"m+xml" tGa7i0n Politik">Gabun Politikrna>">/" e<' />7i0ne-inem-2Seoul-4Seoulref="http://de.wikiactu.com741"m+xml" tGa8391isbre Politik">Gambisbre Politikrna>">/8391ie-inem-2Serafim Urecheanu-4Serafim Urecheanuref="http://de.wikiactu.com741"m+xml" tGa1778isbre Politik">Gambisbre Politikrna>">/1778ie-inem-2Serbisyte Personalie-4Serbisyte Personalieref="http://de.wikiactu.com741"m+xml" tGa293dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />85i0ne-inem-2Sergei Lawrow-4Sergei Lawrowref="http://de.wikiactu.com741"m+xml" tGa253ileo Galilei">Galileo Galileirna>">/" e<253ile-inem-2Sergej Krikaljow-4Sergej Krikaljowref="http://de.wikiactu.com741"m+xml" tGa2085isbre Politik">Gambisbre Politikrna>">/2085ie-inem-2Sergio Chiamparino-4Sergio Chiamparinoref="http://de.wikiactu.com741"m+xml" tGa8750l Mubarak">Gamal Mubarakrna>">/" e<' />8750le-inem-2Sergio García-4Sergio Garcíahref="http://de.wikiactu.com4871ym+xml" t5833isbre Politik">Gambisbre Politikrna>">/583ale-inem-2SES Astra-4SES Astrahref="http://de.wikiactu.com4871ym+xml" t634isbre Politik">Gambisbre Politikrna>">/634le-inem-2Sestriere-4Sestriereref="http://de.wikiactu.com741"m+xml" tGa944iburg im Üechtland">Freiburg im Üechtl944ibe-inem-2Severino Bottero-4Severino Botteroref="http://de.wikiactu.com741"m+xml" tGa4820n Politik">Gabun Politikrna>">/" e<' />4820ne-inem-2Sevilla-4Sevillaref="http://de.wikiactu.com741"m+xml" tGa7830n Politik">Gabun Politikrna>">/" e<' />7830ne-inem-2Sevim Dağdelen-4Sevim Dağdelenhref="http://de.wikiactu.com4871ym+xml" t6578isbre Politik">Gambisbre Politikrna>">/6578ie-inem-2Seweromorsk-4Seweromorskref="http://de.wikiactu.com741"m+xml" tGa785al Mubarak">Gamal Mubarakrna>">/" e<' />785ale-inem-2Sexten-4Sextenhref="http://de.wikiactu.com4871ym+xml" t3505isbre Politik">Gambisbre Politikrna>">/3505ie-inem-2Sexualethik-4Sexualethikref="http://de.wikiactu.com741"m+xml" tGa7i6ball-Bundesliga dt. allg.">Fußball-Bun7965ie-inem-2Sexuelle Belästigung-4Sexuelle Belästigunghref="http://de.wikiactu.com4871ym+xml" t60al Mubarak">Gamal Mubarakrna>">/" e<' />603ie-inem-2Sexueller Missbrauch-4Sexueller Missbrauchref="http://de.wikiactu.com741"m+xml" tGa673iburg im Üechtland">Freiburg im Üechtl673ibe-inem-2Sexueller Mißbrauch von Gefangenen-4Sexueller Mißbrauch von Gefangenenhref="http://de.wikiactu.com4871ym+xml" t5791isbre Politik">Gambisbre Politikrna>">/5791ie-inem-2Seyyed Alī Chāmene'ī-4Seyyed Alī Chāmene'īhref="http://de.wikiactu.com4871ym+xml" t9045isbre Politik">Gambisbre Politikrna>">/904be-inem-2SG Kronau/Östringen-4SG Kronau/Östringenref="http://de.wikiactu.com741"m+xml" tGa414dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/107ie-inem-2Shana Dale-4Shana Daleref="http://de.wikiactu.com741"m+xml" tGa132un Politik">Gabun Politikrna>">/" e<' />1321ie-inem-2Shanghai-4Shanghairef="http://de.wikiactu.com741"m+xml" tGa8456burg im Üechtland">Freiburg im Üechtl8456be-inem-2Shannon Lucid-4Shannon Lucidhref="http://de.wikiactu.com4871ym+xml" t7688isbre Politik">Gambisbre Politikrna>">/7688ie-inem-2Shantou-4Shantouref="http://de.wikiactu.com741"m+xml" tGa1705isbre Politik">Gambisbre Politikrna>">/1705ie-inem-2Sharm El-Sheikh-4Sharm El-Sheikhhref="http://de.wikiactu.com4871ym+xml" t7485isbre Politik">Gambisbre Politikrna>">/7485ie-inem-2Sheffield-4Sheffieldhref="http://de.wikiactu.com4871ym+xml" t332ermittelhersteller">Futtermittelherstel332ee-inem-2Shenyang-4Shenyangref="http://de.wikiactu.com741"m+xml" tGa4697isbre Politik">Gambisbre Politikrna>">/4697ie-inem-2Shenzhen-4Shenzhenref="http://de.wikiactu.com741"m+xml" tGa80ball-Bundesliga dt. allg.">Fußball-Bun805ie-inem-2Shenzhouprogramm-4Shenzhouprogrammref="http://de.wikiactu.com741"m+xml" tGa853iburg im Üechtland">Freiburg im Üechtl853ibe-inem-2Ster Bahadur Deuba-4Sher Bahadur Deubaref="http://de.wikiactu.com741"m+xml" tGa986iburg im Üechtland">Freiburg im Üechtl986ibe-inem-2Sherpa Association-4Sherpa Associationhref="http://de.wikiactu.com4871ym+xml" t3661isbre Politik">Gambisbre Politikrna>">/3661ie-inem-2Sheryl Crow-4Sheryl Crowhref="http://de.wikiactu.com4871ym+xml" t769ileo Galilei">Galileo Galileirna>">/" e<769ile-inem-2Shetlandinseln-4Shetlandinselnhref="http://de.wikiactu.com4871ym+xml" t349dez">Gardezrna>">/" e<' />>
Gambisbre Politikrna>">/3497ie-inem-2Shijian-6-B-4Shijian-6-Bref="http://de.wikiactu.com741"m+xml" tGa717dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />564une-inem-2Shijiazhuang-4Shijiazhuangref="http://de.wikiactu.com741"m+xml" tGa445al Mubarak">Gamal Mubarakrna>">/" e<' />445ale-inem-2Shimon Stein-4Shimon Steinhref="http://de.wikiactu.com4871ym+xml" t9397isbre Politik">Gambisbre Politikrna>">/9397ie-inem-2Shin Corporation-4Shin Corporationhref="http://de.wikiactu.com4871ym+xml" t92ermittelhersteller">Futtermittelherstel924ie-inem-2Shinagawa-4Shinagawaref="http://de.wikiactu.com741"m+xml" tGa4190n Politik">Gabun Politikrna>">/" e<' />41i0ne-inem-2Shinzō Abe-4Shinzō Aberef="http://de.wikiactu.com741"m+xml" tGa955al Mubarak">Gamal Mubarakrna>">/" e<' />955ale-inem-2Siad Barré-4Siad Barréhref="http://de.wikiactu.com4871ym+xml" t6633isbre Politik">Gambisbre Politikrna>">/6633ie-inem-2Šiauliai-4Šiauliaihref="http://de.wikiactu.com4871ym+xml" t391bisbre Politik">Gambisbre Politikrna>">/391bie-inem-2Siberia Airlines-4Siberia Airlineshref="http://de.wikiactu.com4871ym+xml" t6488isbre Politik">Gambisbre Politikrna>">/6488ie-inem-2Sibolga-4Sibolgaref="http://de.wikiactu.com741"m+xml" tGa919ileo Galilei">Galileo Galileirna>">/" e<919ile-inem-2Sichelzellenanämie-4Sichelzellenanämiehref="http://de.wikiactu.com4871ym+xml" t681ermittelhersteller">Futtermittelherstel681ee-inem-2Sicherheit-4Sicherheitref="http://de.wikiactu.com741"m+xml" tGa42ddez">Gardezrna>">/" e<' />>
Gamal Mubarakrna>">/" e<' />556ale-inem-2Sicherheitslücke-4Sicherheitslückeref="http://de.wikiactu.com741"m+xml" tGa196bisbre Politik">Gambisbre Politikrna>">/196bie-inem-2Sicherheitsüberprüfungsgesetz-4Sicherheitsüberprüfungsgesetzhref="http://de.wikiactu.com4871ym+xml" t684ileo Galilei">Galileo Galileirna>">/" e<684ile-inem-2Sicherstellung-4Sicherstellungref="http://de.wikiactu.com741"m+xml" tGa1337isbre Politik">Gambisbre Politikrna>">/1337ie-inem-2Sicherungshaft-4Sicherungshafthref="http://de.wikiactu.com4871ym+xml" t383dez">Gardezrna>">/" e<' />>
Gardezrna>">/" e<' />>
Fußball-Bun8175ie-inem-2Siegbert Zeh-4Siegbert Zehref="http://de.wikiactu.com741"m+xml" tGa7787isbre Politik">Gambisbre Politikrna>">/7787ie-inem-2Siegburg-4Siegburgref="http://de.wikiactu.com741"m+xml" tGa504ileo Galilei">Galileo Galileirna>">/" e<504ile-inem-2Siegen-4Siegenref="http://de.wikiactu.com741"m+xml" tGa186ermittelhersteller">Futtermittelherstel186ee-inem-2Siegfried Buback-4Siegfried Bubackref="http://de.wikiactu.com741"m+xml" tGa271ileo Galilei">Galileo Galileirna>">/" e<271ile-inem-2Siegfried Kauder-4Siegfried Kauderref="http://de.wikiactu.com741"m+xml" tGa130ermittelhersteller">Futtermittelherstel130ee-inem-2Siegfried Schneider-4Siegfried Schneiderref="http://de.wikiactu.com741"m+xml" tGa844iburg im Üechtland">Freiburg im Üechtl844ibe-inem-2Siegfried und Roy-4Siegfried und Royref="http://de.wikiactu.com741"m+xml" tGa443dez">Gardezrna>">/" e<' />>
Gabun Politikrna>">/" e<' />931ee-inem-2Si1"ens AG-4Si1"ens AGref="http://de.wikiactu.com741"m+xml" tGa673ileo Galilei">Galileo Galileirna>">/" e<673ile-inem-2Sierre-4Sierreref="http://de.wikiactu.com741"m+xml" tGa5557isbre Politik">Gambisbre Politikrna>">/5557ie-inem-2Sigi Harreis-4Sigi Harreisref="http://de.wikiactu.com741"m+xml" tGa831n Politik">Gabun Politikrna>">/" e<' />831ie-inem-2Sigmar Gabriel-4Sigmar Gabrielbastián Piñerahref="http://de.wikiactu.co80n Politik">Gabun Politikrna>">/" e<' />5e>">/" e<' />5e>">/" e<' />5e>">/" e<' />5e>">echtapp://de.wiki8Vef="http://de.wiki>Gambisbreanolitikrna>">/" e<' />5e>">/" e<' />5e>">/" e<' />5ref="http:/w/>5e>">/" e<' /i/de.w/i/dm741"m+xml" tGa831n Politik">Gabun Politik2ileirna>">/" e<504ile-inem-2Siegen-4Siegek2ile">/" e<' /kn Ptp://kn Ptm741"m+xml" tGa7787isbre Politik">Gambisbr0 Politikrna>">/4195ie-inem-2Selig"nstadt-r0 Po">/" e<' /khismu/de.wkhismu/om4871ym+xml" t302ileo Galilei">Galileo Gal Politikrna>">/9651ie-inem-2Sensors Unlimal Po">/" e<' /ku.cottp:/ku.cotm741"m+xml" tGa817ball-Bundesliga dt. allg.urg im Üechtl844ibe-inem-2Siegfried und 14Schiffsverk/ku.cot S->> >om4871ym+xml" t6633isbre Politik">Gambisbre Politikrna>">/6525ie-inem-2Schäftlarn-4S625chiffsverk/ku.cot UH-rna>k/ku.cot UH-rnm741"m+xml" tGa130ermittelhersteller">Fut6ileirna>">/" e<504ile-inem-2Siegen-4Sieget6ilehiffsverk/licde.wraphic/de.wlicde.wraphic/m741"m+xml" tGa196bisbre Politik">Gambisbreermittelherstel681ee-inem-2Sicherheit-4Sreermhiffsverk/li//de.wi/li//dem741"m+xml" tGa7357isbre Politik">Gambisbre rmittelherstel726ee-inem-2Sendai-4Sendai35rmhiffsverk/lviactKoch-Mehde.wik/lviactKoch-Mehde.m741"m+xml" tGa225iburg im Üechtland">Frei4na>">/" e<' />2760ne-inem-2Schipkau-4Schii4nahiffsverk/lvikiaonewik/lvikiaonem741"m+xml" tGa196bisbre Politik">Gambisbreurg im Üechtl123ibe-inem-2Sebastian Kehlhtsbarkeit-4/lvioiactuuscdeiwik/lvioiactuuscdeim741"m+xml" tGa955al Mubarak">Gamal Mubarakrna>">/" e<' />603ie-inem-2Sexueller Missakrnabarkeit-4/matu.c9wik/matu.c9m741"m+xml" tGa9651isbre Politik">Gambisbre7Politikrna>">/9397ie-inem-2Shin Corporatie7Pobarkeit-4/mferopoPiñemferopoPm741"m+xml" tGa225iburg im Üechtland">Fre6.">Fußball-Bun805ie-inem-2Shenzhouprograe6.">barkeit-4/mde.Jwikisf="ht/mde.Jwikisf=m741"m+xml" tGa293dez">Gardezrna>">/" e<' /7na>">/" e<' />28une-inem-2Schule allg.-4S/7nabarkeit-4/mde.Rolfhttp:/mde.Rolfhtm741"m+xml" tGa986iburg im Üechtland">Frei Politikrna>">/1337ie-inem-2Sicherungshafei Pobarkeit-4/mdee Thowikiatp:/mdee Thowikiam741"m+xml" tGa271ileo Galilei">Galileo Gal Politikrna>">/634le-inem-2Sestriere-4Sesal Pobarkeit-4/niactr/de.tp:/niactr/de.m741"m+xml" tGa271ileo Galilei">Galileo Ga8.urg im Üechtl844ibe-inem-2Siegfried unda8.urbarkeit-4/ndelfnref="ht/ndelfnref=m741"m+xml" tGa7787isbre Politik">Gambisbrerna>">/" e<' />4820ne-inem-2Sevilla-4Sevirernabarkeit-4/ndctu.r"ht/ndctu.rm741"m+xml" tGa271ileo Galilei">Galileo Ga4ileirna>">/" e<919ile-inem-2Sichelzellenaa4ilebarkeit-4/ngaporeshref="http:/ngaporeshref="htm741"m+xml" tGa271ileo Galilei">Galileo Ga4iPolitikrna>">/2778ie-inem-2Schuhindustrie4leusungref="/ngapurtp:/ngapucom4871ym+xml" t327ileo Galilei">Galileo Ga7burg im Üechtl844ibe-inem-2Siegfried unda7bursungref="/ng.wikHohwikwttp)tp:/ng.wikHohwikwttp)m741"m+xml" tGa225iburg im Üechtland">Fre6>>
> sungref="INOSAT-na>"INOSAT-nm741"m+xml" tGa225iburg im Üechtland">Fre6>Politikrna>">/254bie-inem-2SC Freiburg-4S6urgref="httpINOSAT-2a>"INOSAT-2m741"m+xml" tGa225iburg im Üechtland">Fre6>Politikrna>">/2778ie-inem-2Schuhindustrieouref="http:/INOSAT-3a>"INOSAT-3m741"m+xml" tGa196bisbre Politik">Gambisbre Politikrna>">/130ale-inem-2Schliersee-4Sc9rnabarkeit-4/nsheimtp:/nsheimom4871ym+xml" t3505isbre Politik">Gambisbre Politikrna>">/196bie-inem-2Sicherheitsüre Pobarkeit-4/http:u.com4871ym+xml" t92ermittelhersteller">Fu48ermittelherstel977ee-inem-2Schallod"nbac48ermaihref="hırna://hırna:om4871ym+xml" t7485isbre Politik">Gambisbre/" e<' />> ">/" e<271ile-inem-2Siegfried Kaulgilebarkeit-4/ttare.wi/ttareom4871ym+xml" t513isbre Politik">Gambisbre leirna>">/" e<504ile-inem-2Siegen-4Siegenilebarkeit-4/ttde.wn.wi/ttde.wn://de.wikiactu.co80n Politik">Gabun Politikermittelherstel516ee-inem-2Schriftsteller3k-4Siegfried xt/de.wikxt/dem741"m+xml" tGa986iburg im Üechtland">Frei Politikrna>">/4195ie-inem-2Selig"nstadt-ei PoSiegfried ziactu Btu.crtp:/ziactu Btu.crm741"m+xml" tGa225iburg im Üechtland">Fre1rna>">/" e<' />955ale-inem-2Siad Barré-4e1rnaSiegfriedK Rapid Wiwn.wiK Rapid Wiwnm741"m+xml" tGa5557isbre Politik">Gambisbre na>">/" e<' />556ale-inem-2SicherheitslücrnaSiegfriedkelethttp:kelethtm741"m+xml" tGa293dez">Gardezrna>">/" e<' /.">Fußball-Bun7965ie-inem-2Sexuelle Bel2stigung-4Sexuki (Alpin)hreki (Alpin)om4871ym+xml" t327ileo Galilei">Galileo Ga7Politikrna>">/3883ie-inem-2SdK-4SdKref="h73gung-4Sexuki (ukispu.co)hreki (ukispu.co)m741"m+xml" tGa5557isbre Politik">Gambisbreileirna>">/" e<673ile-inem-2Sierre-4Sierr5ow-4Sergej Krkictu.laufhrekictu.laufom4871ym+xml" t5791isbre Politik">Gambisbrerna>">/" e<' />1321ie-inem-2Shanghai-4SharernaSergej Krklav://de.wklav://dom4871ym+xml" t684ileo Galilei">Galileo Gali>
Futtrna>">/" e<' />2760ne-inem-2Schipkau-4Schttrnabani Nondkulpturtp:kulpturm741"m+xml" tGa817ball-Bundesliga dt. all.">Fußball-Bun7965ie-inem-2Sexuelle Bel8tigung-4Sexukybolde.wkyboldm741"m+xml" tGa7357isbre Politik">Gambisbre mittelherstel726ee-inem-2Sendai-4Sendai35gung-4Sexukynede.wkyn.com4871ym+xml" t5318leo Galilei">Galileo Ga9ermittelherstel568ee-inem-2Scientology-4S9eref="http:/ky"httpky"hm741"m+xml" tGa271ileo Galilei">Galileo Ga8rna>">/" e<' />2760ne-inem-2Schipkau-4Schi8rnabani Nondledge-Eis.wikettp:ledge-Eis.wiketm741"m+xml" tGa7357isbre Politik">Gambisbr5burg im Üechtl225ibe-inem-2Science-Fictir5burbani NondlobodiacMiloševićtp:lobodiacMiloševićom4871ym+xml" t769ileo Galilei">Galileo Gal>>
Freiburg im Üechtl8456be-inem-2Shannon Lucid-44an-7ref="htlowak/de.wlowak/dom4871ym+xml" t327ileo Galilei">Galileo Galileirna>">/" e<673ile-inem-2Sierre-4Sierralile-7ref="htlowakyte Politikhref=lowakyte Politikhrom4871ym+xml" t92ermittelhersteller">Futtrna>">/" e<' />1321ie-inem-2Shanghai-4Shattrna-7ref="htlowakyte PscMilitär://de.wilowakyte PscMilitär://dem741"m+xml" tGa844iburg im Üechtland">Fre9rna>">/" e<' />8750le-inem-2Sergio García94Sergio GarcMER.wiMERm741"m+xml" tGa9651isbre Politik">Gambisbre Politikrna>">/3661ie-inem-2Sheryl Crow-49heryl Crowhremoljf="htmoljf=m741"m+xml" tGa186ermittelhersteller">Futtburg im Üechtl844ibe-inem-2Siegfried undttburl Crowhremos"htmo/m741"m+xml" tGa196bisbre Politik">Gambisbreileirna>">/" e<127ile-inem-2Schienenfahrze9aref="http:/M.wikMcom4871ym+xml" t9091isbre Politik">Gambisb13>>
> f="http:/N Brude.wsshref="http:N Brude.wsshref="htom4871ym+xml" t684ileo Galilei">Galileo Ga2 Politikrna>">/904be-inem-2SG Kronau/Ösa2 Pof="http:/NCFtp:NCFm741"m+xml" tGa4697isbre Politik">Gambisbrerna>">/" e<' />7830ne-inem-2Sevim Dağdelrernaf="http:/noode.wiknoode.om4871ym+xml" t92ermittelhersteller">Futtrurg im Üechtl986ibe-inem-2Sherpa Associa2immerhref="hnowboarecrosswiknowboarecrossm741"m+xml" tGa844iburg im Üechtland">Fre9rurg im Üechtl844ibe-inem-2Siegfried und rsonalie-4SchN.wikNcom4871ym+xml" t9091isbre Politik">Gambisbr5rna>">/" e<' />4270ne-inem-2Schweich-4Schr5rnaerhref="hnyp://Rieiwiknyp://Rieiom4871ym+xml" t302ileo Galilei">Galileo Galileirna>">/" e<327ile-inem-2Selenia-4Selen0aref="http:/oSelatp:oSelaom4871ym+xml" t302ileo Galilei">Galileo Ga1rna>">/" e<' />556ale-inem-2Sicherheitsla1rnaf="http:/oSialdemokactuede.woSialdemokactuedom4871ym+xml" t9091isbre Politik">Gambisb11rna>">/" e<' />955ale-inem-2Siad Barré-411rnaSiegfriedoSiété Génér/de.wioSiété Génér/dem741"m+xml" tGa196bisbre Politik">GambisbreePolitikrna>">/1705ie-inem-2Sharm El-Sheik9n Bethref="hofwikiaofwiom4871ym+xml" t684ileo Galilei">Galileo Garna>">/" e<' />7710ne-inem-2Seilbahnverke6-4Seilbahnveoftwaikiacoftwaikom4871ym+xml" t6578isbre Politik">GambisbrePolitikrna>">/904be-inem-2SG Kronau/Ösa55Seilbahnveoftwaikugherstellerhoftwaikugherstellm741"m+xml" tGa271ileo Galilei">Galileo Ga4 Politikrna>">/196bie-inem-2Sicherheitsü2-4Schmerzensgoftwaikpat="httpoftwaikpat="hm741"m+xml" tGa817ball-Bundesliga dt. all.0na>">/" e<' />831ie-inem-2Sigmar Gabriel-.0nahmerzensgoichactuguchattpoichactugucham741"m+xml" tGa186ermittelhersteller">Futtileirna>">/" e<550ile-inem-2Schweizer Ferttilehmerzensgojus (Kapstp)tp:ojus (Kapstp)m741"m+xml" tGa271ileo Galilei">Galileo Ga5 Politikrna>">/5791ie-inem-2Seyyed Alī Ca5 Pohmerzensgojus (Rak/te)tp:ojus (Rak/te)m741"m+xml" tGa817ball-Bundesliga dt. all.rna>">/" e<' />85i0ne-inem-2Sergei Lawrow-6inzō AberefokoPiñokoPom4871ym+xml" t60al Mubarak">Gamal Mubarakr.urg im Üechtl844ibe-inem-2Siegfried undkr.urō Aberefolar Dynamics Observatorttp:olar Dynamics Observatortm741"m+xml" tGa919ileo Galilei">Galileo Galburg im Üechtl944ibe-inem-2Severino Botte14urō Aberefolar Millennium/de.wiolar Millennium/deom4871ym+xml" t60al Mubarak">Gamal Mubarak3ileirna>">/" e<601ile-inem-2Scott Brown-4S3ilebarkeit-4olar//de.olar//m741"m+xml" tGa186ermittelhersteller">Futtrna>">/" e<' />85i0ne-inem-2Sergei Lawrowttrnabarkeit-4oldahttpoldahom4871ym+xml" t513isbre Politik">Gambisbre urg im Üechtl944ibe-inem-2Severino Bott5nref="http:/ölwikiacölwikom4871ym+xml" t769ileo Galilei">Galileo Ga2ileirna>">/" e<205ile-inem-2Schockzustanda2ilebarkeit-4olnref="htolnref=om4871ym+xml" t60al Mubarak">Gamal Mubarakeermittelherstel681ee-inem-2Sicherheit-4S6eermhiffsverkótellerhótellom4871ym+xml" t769ileo Galilei">Galileo Ga2 Politikrna>">/904be-inem-2SG Kronau/Ös72 Pof="http:/olnikiaolnim741"m+xml" tGa9651isbre Politik">Gambisbre0urg im Üechtl944ibe-inem-2Severino Bottee0urf="http:/olnhoff="htolnhoff=m741"m+xml" tGa4697isbre Politik">Gambisbr9ermittelherstel130ee-inem-2Siegfried Schr9ermf="http:/olothur="htolothur=om4871ym+xml" t391bisbre Politik">Gambisbre>>
> f="http:/olothur= (Kanton)hreolothur= (Kanton)://de.wikiactu.co80n Politik">Gabun PolitikiPolitikrna>">/2778ie-inem-2SchuhindustriikiPof="http:/omchai Wongsawahttpomchai Wongsawah://de.wikiactu.co80n Politik">Gabun Politikrna>">/" e<' />28une-inem-2Schule allg.-45Schule allg.hotu.c-Grand-Prix-ukispu/ng.wi20/" ehotu.c-Grand-Prix-ukispu/ng.wi20/"m741"m+xml" tGa9651isbre Politik">Gambisbr4ermittelherstel900ee-inem-2Seerecht-4Seer4ermf="http:/ötu.c://deötu.c:/om4871ym+xml" t684ileo Galilei">Galileo Ga2rna>">/" e<' />5e>">/" e<' />5e>">/" e<' a2rnale allg.hondtu.co.wikihof für ctu.ca Leonewikondtu.co.wikihof für ctu.ca Leoneom4871ym+xml" t92ermittelhersteller">Fu483" e<' />> Futi4na>">/" e<' />2760ne-inem-2Schipkau-4Sch1i4nahiffsverkondhacLimthongkkiactondhacLimthongkkim741"m+xml" tGa817ball-Bundesliga dt. all.7Politikrna>">/9397ie-inem-2Shin Corporat8e7Pobarkeit-4onja//de.Norw.wikiaconja//de.Norw.wikom4871ym+xml" t327ileo Galilei">Galileo Ga7>>
> barkeit-4onnewikonneom4871ym+xml" t92ermittelhersteller">Fu57ermittelherstel568ee-inem-2Scientology-4S7eref="http:/onneergref=onneergrm741"m+xml" tGa225iburg im Üechtland">Fre1 Politikrna>">/5791ie-inem-2Seyyed Alī Ca Fußballnationnenmiss/http:onnenmiss/htom4871ym+xml" t391bisbre Politik">Gambisbre leirna>">/" e<327ile-inem-2Selenia-4Selen9ilebarkeit-4onsbettp:/onsbettom4871ym+xml" t302ileo Galilei">Galileo Galiurg im Üechtl844ibe-inem-2Siegfried undar.urō Aberefoniacte Hilfsorganisf="http:oniacte Hilfsorganisf="htm741"m+xml" tGa831n Politik">Gabun Politikrrna>">/" e<' />7830ne-inem-2Sevim Dağdelkrrnaō Aberefoniacter Weltrekore.wioniacter Weltrekorem741"m+xml" tGa7787isbre Politik">GambisbreePolitikrna>">/1705ie-inem-2Sharm El-SheireePoō Aberefoniactes Raumfahrtträtersyersm.wioniactes Raumfahrtträtersyersmm741"m+xml" tGa186ermittelhersteller">Fut0e mittelherstel726ee-inem-2Sendai-4Sendat0e mō AberefonthacBoonyaratglittp:onthacBoonyaratglitm741"m+xml" tGa831n Politik">Gabun Politik21urg im Üechtl8456be-inem-2Shannon Lucid-21urō Aberefonthoff="htonthoff=om4871ym+xml" t302ileo Galilei">Galileo Ga4/" e<' />> Fu4e Politikrna>">/51ale-inem-2Seilbahnbetrei4ber-4Seilbahnophia /de.wriactunltp://dophia /de.wriactunltp:m741"m+xml" tGa9651isbre Politik">Gambisbr7ileirna>">/" e<504ile-inem-2Siegen-4Sieger7ile4Seilbahnorbonnewikorbonneom4871ym+xml" t60al Mubarak">Gamal Mubarakr>>
> 4Seilbahnorg://de.wikorg://de.m741"m+xml" tGa986iburg im Üechtland">Freiileirna>">/" e<916ile-inem-2Sebastian Deis8er-4SebastiaosolnPtp:/osolnPtom4871ym+xml" t60al Mubarak">Gamal Mubarakrrna>">/" e<' />8750le-inem-2Sergio Garcíkrrna4Sebastiaotheby’/de.otheby’/om4871ym+xml" t60al Mubarak">Gamal Mubarak3Politikrna>">/6633ie-inem-2Šiauliai-4ŠiAstrahref="hode.wattpode.waom4871ym+xml" t3505isbre Politik">Gambisbreleirna>">/" e<327ile-inem-2Selenia-4Selenilebarkeit-4okiactokim741"m+xml" tGa817ball-Bundesliga dt. al79burg im Üechtl853ibe-inem-2Ster Bahadur 79burbarkeit-4okth Afo.wanshreway/de.okth Afo.wanshreway/om4871ym+xml" t93un Politik">Gabun Politikrburg im Üechtl944ibe-inem-2Severino Botte34urbarkeit-4okth Afo.wansSpace Awikcyde.okth Afo.wansSpace Awikcym741"m+xml" tGa817ball-Bundesliga dt. alllileirna>">/" e<272ile-inem-2Schwedisyte F8ßballnationaokth Bep://dokth Bep:m741"m+xml" tGa186ermittelhersteller">Futi Politikrna>">/3661ie-inem-2Sheryl Crow-4ti Pollnationaokth Carolnra//dokth Carolnraom4871ym+xml" t6633isbre Politik">Gambisbre Politikrna>">/5557ie-inem-2Sigi Harreis-re Pollnationaokth Yorkshiikiacokth Yorkshiikm741"m+xml" tGa817ball-Bundesliga dt. all5>>
> llnationaokthampthttp:okthampthtm741"m+xml" tGa186ermittelhersteller">Fut7 Politikrna>">/9651ie-inem-2Sensors Unlimt7 Pollnationaokthamptht F.C.tp:okthamptht F.C.m741"m+xml" tGa817ball-Bundesliga dt. al71ileirna>">/" e<205ile-inem-2Schockzustanda15ballnationaokthwestshref="http:okthwestshref="htom4871ym+xml" t9091isbre Politik">Gambisb13rna>">/" e<' />955ale-inem-2Siad Barré-413rnaSiegfriedozia//de.w.wef="htozia//de.w.wef=om4871ym+xml" t6633isbre Politik">Gambisbre Politikrna>">/904be-inem-2SG Kronau/Ösa6 Pof="http:/ozia//dKompetenz"htozia//dKompetenzm741"m+xml" tGa7787isbre Politik">Gambisbr0Politikrna>">/4195ie-inem-2Selig"nstadt-r0Pof="http:/ozia//dttp://de."htozia//dttp://de.m741"m+xml" tGa196bisbre Politik">Gambisbre3" e<' />> Gamal Mubarakeurg im Üechtl844ibe-inem-2Siegfried undkhtsbarkeit-4ozia/.co.wikiactuittp:ozia/.co.wikiactuitm741"m+xml" tGa9651isbre Politik">Gambisbree mittelherstel726ee-inem-2Sendai-4Sendaree mbarkeit-4ozia/.co.wikiarede.wikozia/.co.wikiarede.om4871ym+xml" t92ermittelhersteller">Futtileirna>">/" e<504ile-inem-2Siegen-4Sieger2ile">/" e<' ozia/.co.wikiDarmttp://deozia/.co.wikiDarmttp:/om4871ym+xml" t3505isbre Politik">Gambisbr3iurg im Üechtl844ibe-inem-2Siegfried unda37tsbarkeit-4ozia/.co.wikiDüde.w//de.wiozia/.co.wikiDüde.w//dem741"m+xml" tGa673ileo Galilei">Galileo Galrurg im Üechtl844ibe-inem-2Siegfried undalrurbarkeit-4ozia/hilfe.wiozia/hilfem741"m+xml" tGa817ball-Bundesliga dt. al71ileirna>">/" e<769ile-inem-2Shetlandinselnämie-4Sichelozia/olitikref=ozia/olitikrom4871ym+xml" t3505isbre Politik">Gambisbr8ermittelherstel568ee-inem-2Scientology-4r8erme-4Sichelozia///de.wikozia///de.om4871ym+xml" t9091isbre Politik">Gambisbr5ermittelherstel924ie-inem-2Shinagawa-4Shi54rme-4Sichelozia/we.wikiactu.wikozia/we.wikiactu.m741"m+xml" tGa817ball-Bundesliga dt. alllburg im Üechtl438ibe-inem-2Schwerin-4Schllbure-4SichelP (Nwikirlän://de.wiartei)hreP (Nwikirlän://de.wiartei)m741"m+xml" tGa817ball-Bundesliga dt. al798leirna>">/" e<769ile-inem-2Shetlandinseln98lee-4SichelP (ttp://de.wiartei)hreP (ttp://de.wiartei)om4871ym+xml" t92ermittelhersteller">Fu40rna>">/" e<' />423ale-inem-2Schweizergarde0Astrahref="hpa-e.wicorchampttp:pa-e.wicorchamptm741"m+xml" tGa919ileo Galilei">Galileo GalPolitikrna>">/9191ie-inem-2Senegalesisyte 1trahref="hpace Adventurettp:pace Adventuretm741"m+xml" tGa225iburg im Üechtland">Fre65Politikrna>">/2778ie-inem-2Schuhindustrieo58trahref="hpace Services Inc.tp:pace Services Inc.om4871ym+xml" t327ileo Galilei">Galileo Ga7 Politikrna>">/391bie-inem-2Siberia Airlin>5e>">/" e<' pace Syersms/Lowikiacpace Syersms/Lowikm741"m+xml" tGa225iburg im Üechtland">Fre65Politikrna>">/254bie-inem-2SC Freiburg-4S65e>">/" e<' paceLoft XLiacpaceLoft XLm741"m+xml" tGa817ball-Bundesliga dt. al71na>">/" e<' />785ale-inem-2Sexten-4Sexten13>">/" e<' paceportshmco.waiacpaceportshmco.waom4871ym+xml" t93un Politik">Gabun Politikrrurg im Üechtl986ibe-inem-2Sherpa Associa3immerhref="hpaceports:/ngaporeiacpaceports:/ngaporem741"m+xml" tGa271ileo Galilei">Galileo Ga5rna>">/" e<' />7830ne-inem-2Sevim Dağdela5rnaerhref="hpaceship Oneiacpaceship Onem741"m+xml" tGa817ball-Bundesliga dt. all.>
Fut0urg im Üechtl844ibe-inem-2Siegfried undt02t-4Sicherhpaceshue.wikiapaceshue.wim741"m+xml" tGa7357isbre Politik">Gambisbr5urg im Üechtl225ibe-inem-2Science-Fictir52t-4Sicherhpaceway 2kiapaceway 2om4871ym+xml" t327ileo Galilei">Galileo Ga62Politikrna>">/391bie-inem-2Siberia Airlin62Po-4SicherhpaceXkiapaceX://de.wikiactu.co80n Politik">Gabun Politikermittelherstel924ie-inem-2Shinagawa-4Shikerm-4Sicherhpanairkiapanairom4871ym+xml" t513isbre Politik">Gambisbre lurg im Üechtl944ibe-inem-2Severino Bott5n92t-4Sicherhpanschaft-4Senegalesisyte Fußballnatipanschaft-4Senegalesisyte Fußballnm741"m+xml" tGa844iburg im Üechtland">Fre9ileirna>">/" e<769ile-inem-2Shetlandinsele9ile-4SicherhpanschaftGrippeatipanschaftGrippem741"m+xml" tGa130ermittelhersteller">FuttrPolitikrna>">/1337ie-inem-2Sicherungshaft-67e-4SicherhpanschafscMilitär://de.wipanschafscMilitär://deom4871ym+xml" t684ileo Galilei">Galileo Galileirna>">/" e<673ile-inem-2Sierre-4Sierre83le-4Sicherhparkn Peatiparkn Peom4871ym+xml" t92ermittelhersteller">Fu40Politikrna>">/9191ie-inem-2Senegalesisyt40nahmerzensgPDhrePDm741"m+xml" tGa831n Politik">Gabun Politik21na>">/" e<' />7830ne-inem-2Sevim Dağdelk2-4Seilbahnvepearstu.ceatipearstu.cem741"m+xml" tGa271ileo Galilei">Galileo Ga75Politikrna>">/254bie-inem-2SC Freiburg-4S75e>">/" e<' peer:/rff="htpeer:/rff=om4871ym+xml" t684ileo Galilei">Galileo Galileirna>">/" e<769ile-inem-2Shetlandinselalile">/" e<' perrbezip://dperrbezip:om4871ym+xml" t684ileo Galilei">Galileo Galburg im Üechtl8456be-inem-2Shannon Lucidalbur">/" e<' perrgebuede.wperrgebuedm741"m+xml" tGa831n Politik">Gabun Politik2ermittelherstel870ee-inem-2Schwimmbad-4Sc2ermf="http:/perrstundee.wperrstundem741"m+xml" tGa7357isbre Politik">Gambisbr8rna>">/" e<' />28une-inem-2Schule allg.-4r8rnaf="http:/perrzonewikperrzonem741"m+xml" tGa4697isbre Politik">Gambisbre leirna>">/" e<327ile-inem-2Selenia-4Selere lef="http:/peyllerhpeyllom4871ym+xml" t513isbre Politik">Gambisbre4rna>">/" e<' />2760ne-inem-2Schipkau-4Sche4rnaf="http:/pezia//insatzkom Fudoiacpezia//insatzkom Fudom741"m+xml" tGa271ileo Galilei">Galileo Ga2ermittelherstel977ee-inem-2Schallod"nbaca2ermf="http:/pn Piñpttp://de.wikiactu.co80n Politik">Gabun Polit2rrurg im Üechtl986ibe-inem-2Sherpa Associ23immerhref="hpttpbco.wikiñpttpbco.wikom4871ym+xml" t302ileo Galilei">Galileo Ga4/leirna>">/" e<327ile-inem-2Selenia-4Selen4ilehmerzensgpttpekonsoceatipttpekonsoceom4871ym+xml" t5318leo Galilei">Galileo Ga9mittelherstel568ee-inem-2Scientology-4S9ehmerzensgpttper:/de.wPiñpttper:/de.wPom4871ym+xml" t327ileo Galilei">Galileo Ga64" e<' />> Gambisbre Politikrna>">/130ale-inem-2Schliersee-4Sre Pohmerzensgpttphalceatipttphalceom4871ym+xml" t9091isbre Politik">Gambisb114na>">/" e<' />2760ne-inem-2Schipkau-4Sch114nahiffsverkpttpsuwikiñpttpsuwikm741"m+xml" tGa293dez">Gardezrna>">/" e<' / Politikrna>">/107ie-inem-2Shana Dale-4Sh / Pohiffsverkpttpwaiknhandeliñpttpwaiknhandel://de.wikiactu.co80n Politik">Gabun Politik Politikrna>">/583ale-inem-2SES Astra-4SES233ohiffsverkpttpwaiknme Peatipttpwaiknme Pem741"m+xml" tGa4697isbre Politik">Gambisbr7rna>">/" e<' />4270ne-inem-2Schweich-4Schr7rnahiffsverkpttpwikiatipttpwikiom4871ym+xml" t302ileo Galilei">Galileo Ga1ePolitikrna>">/1705ie-inem-2Sharm El-Sheia1ePohiffsverkptoiactatiptoiactom4871ym+xml" t327ileo Galilei">Galileo Ga60na>">/" e<' />4270ne-inem-2Schweich-4Scha60nahiffsverkptrikiñptrcom741"m+xml" tGa42ddez">Gardezrna>">/" e<'51ileirna>">/" e<504ile-inem-2Siegen-4Siegen149ehmerzensgptrtshvactude.wiptrtshvactudem741"m+xml" tGa831n Politik">Gabun Politik0a9mittelherstel568ee-inem-2Scientology-4k0a9mhmerzensgpttzctu.c="htpttzctu.c=m741"m+xml" tGa196bisbre Politik">Gambisbre3>
Fut7rna>">/" e<' />564une-inem-2Shijiazhuang-t7rnahmerzensgponsou/ng"htponsou/ngom4871ym+xml" t513isbre Politik">Gambisbre u>
hmerzensgpo/de.wpo/dom4871ym+xml" t6633isbre Politik">Gambisbrerna>">/" e<' />7710ne-inem-2Seilbahnverke66-4Seilbahnveportsim V://dnigten König//df="htportsim V://dnigten König//df=m741"m+xml" tGa271ileo Galilei">Galileo Ga2ileirna>">/" e<916ile-inem-2Sebastian Deia2ileeilbahnveportsin Au//deliwn.wiportsin Au//deliwnom4871ym+xml" t513isbre Politik">Gambisbre88leirna>">/" e<769ile-inem-2Shetlandinsele88leeilbahnveportsin Brasiliwn.wiportsin Brasiliwnm741"m+xml" tGa7787isbre Politik">Gambisbr08Politikrna>">/130ale-inem-2Schliersee-4Sr08Poeilbahnveportsin Brede.wikportsin Brede.om4871ym+xml" t513isbre Politik">Gambisbre8rna>">/" e<' />831ie-inem-2Sigmar Gabriel5-4Sigmar Gabrportsin Chnra//dportsin Chnram741"m+xml" tGa673ileo Galilei">Galileo Galrrmittelherstel681ee-inem-2Sicherheit-4S675rmhiffsverkportsin den Nwikirla.wikiacportsin den Nwikirla.wikm741"m+xml" tGa271ileo Galilei">Galileo Ga.">Fußball-Bun805ie-inem-2Shenzhouprograe0Pof="http:/portsin den V://dnigten Staatikiacportsin den V://dnigten Staatikm741"m+xml" tGa4697isbre Politik">Gambisbr15urg im Üechtl225ibe-inem-2Science-Fictir15urf="http:/portsin der ttp://diacportsin der ttp://dm741"m+xml" tGa844iburg im Üechtland">Fre9Politikrna>">/130ale-inem-2Schliersee-4Se9Pof="http:/portsin Deude.wltp://dportsin Deude.wltp:://de.wikiactu.co80n Politik">Gabun Politik0urg im Üechtl844ibe-inem-2Siegfried undik0urf="http:/portsin Eu.lap://dportsin Eu.lap:m741"m+xml" tGa271ileo Galilei">Galileo Ga85Politikrna>">/254bie-inem-2SC Freiburg-4S85e>">/" e<' portsin Europa//dportsin Europaom4871ym+xml" t391bisbre Politik">Gambisbre0urg im Üechtl844ibe-inem-2Siegfried undre0ur">/" e<' portsin e.wik//df="htportsin e.wik//df=m741"m+xml" tGa7787isbre Politik">Gambisbr4ermittelherstel681ee-inem-2Sicherheit-4Sr4erm">/" e<' portsin wriactunltp://dportsin wriactunltp:om4871ym+xml" t60al Mubarak">Gamal Mubarakerna>">/" e<' />556ale-inem-2Sicherheitslkerna">/" e<' portsin Hamde.wikiportsin Hamde.wm741"m+xml" tGa4697isbre Politik">Gambisbr15leirna>">/" e<327ile-inem-2Selenia-4Seler15ballnationaportsin Iteliwn.wiportsin Iteliwnm741"m+xml" tGa7787isbre Politik">Gambisbr4rurg im Üechtl986ibe-inem-2Sherpa Associr4rurllnationaportsin Kat.r"htportsin Kat.r://de.wikiactu.co80n Politik">Gabun Politik0Politikrna>">/583ale-inem-2SES Astra-4SES20na">/" e<' portsin Kroctuen.wiportsin Kroctuenm741"m+xml" tGa7787isbre Politik">Gambisbr4e>
/" e<' portsin Liacttde.tp://deportsin Liacttde.tp:/://de.wikiactu.co80n Politik">Gabun Politi6>>
> ">/" e<' portsin ikiau.codf="htportsin ikiau.codf=://de.wikiactu.co80n Politik">Gabun Politi0lurg im Üechtl944ibe-inem-2Severino Bott509urllnationaportsin Polen.wiportsin Polenm741"m+xml" tGa7787isbre Politik">Gambisbr0lurg im Üechtl944ibe-inem-2Severino Bott709urllnationaportsin Rumänuen.wiportsin Rumänuenom4871ym+xml" t513isbre Politik">Gambisbre4ermittelherstel924ie-inem-2Shinagawa-4Shi44rm">/" e<' portsin Russltp://dportsin Russltp:m741"m+xml" tGa7787isbre Politik">Gambisbr0ermittelherstel924ie-inem-2Shinagawa-4Shr0erm">/" e<' portsin ipansen.wiportsin ipansenm741"m+xml" tGa7787isbre Politik">GambisbrtrPolitikrna>">/1337ie-inem-2Sicherungshaf7-67e-4Sicherhportsin iüdkorea//dportsin iüdkorea://de.wikiactu.co80n Politik">Gabun Politiklurg im Üechtl944ibe-inem-2Severino Bott529urllnationaportsin Thailtp://dportsin Thailtp:m741"m+xml" tGa4697isbre Politik">Gambisbr1 Politikrna>">/1337ie-inem-2Sicherungshafr1 Pollnationaportsin Tu/nidakiactuTobago//dportsin Tu/nidakiactuTobagoom4871ym+xml" t513isbre Politik">Gambisbre rna>">/" e<' />2760ne-inem-2Schipkau-4Sche164Seilbahnveportsin Tchafchsen.wiportsin Tchafchsenom4871ym+xml" t3505isbre Politik">Gambisbrerna>">/" e<' />5e>">/" e<' />5e>">/" e<' rernaeilbahnveportakrobaikref=portakrobaikrm741"m+xml" tGa9651isbre Politik">Gambisbr4.>
eilbahnveportfunksisyär"htportfunksisyärom4871ym+xml" t3505isbre Politik">Gambisbr81" e<' />> Gambisbr2burg im Üechtl438ibe-inem-2Schwerin-4Schr2bureilbahnveportreporter allg..wiportreporter allg.m741"m+xml" tGa4697isbre Politik">Gambisbr3 Politikrna>">/4195ie-inem-2Selig"nstadt-r3 Poeilbahnveportttp:"http:portttp:"htom4871ym+xml" t9091isbre Politik">Gambisb110Politikrna>">/9191ie-inem-2Senegalesisyt110Poeilbahnveportunfalltp:portunfallm741"m+xml" tGa271ileo Galilei">Galileo Ga.Politikrna>">/254bie-inem-2SC Freiburg-4S0Pollnationaportve.wittpltung allg..wiportve.wittpltung allg.m741"m+xml" tGa7787isbre Politik">Gambisbrt Politikrna>">/5791ie-inem-2Seyyed Alī Crt Pollnationaportve.wittpltung imt-4Senega.wiportve.wittpltung imt-4Senegaom4871ym+xml" t9091isbre Politik">Gambisb11 Politikrna>">/1337ie-inem-2Sicherungshaft1 Pollnationaportwette allg..wiportwette allg.m741"m+xml" tGa831n Politik">Gabun Politikrrna>">/" e<' />8750le-inem-2Sergio García35naeilbahnveportzef="chrife.wiportzef="chrifem741"m+xml" tGa271ileo Galilei">Galileo Ga8burg im Üechtl853ibe-inem-2Ster Bahadur a8bureilbahnveprachkulturtp:prachkulturm741"m+xml" tGa844iburg im Üechtland">Fre97Politikrna>">/9397ie-inem-2Shin Corporat897Pobarkeit-4prendlnref="htprendlnref=m741"m+xml" tGa817ball-Bundesliga dt. al71/" e<' />> Gambisbr9/" e<' />> Gambisbr.rna>">/" e<' />85i0ne-inem-2Sergei Lawrow96inzō Aberefputnik na>"putnik nom4871ym+xml" t3505isbre Politik">Gambisbr3 Politikrna>">/196bie-inem-2Sicherheitsür-67e-4SicherhpVgg wreut://dFürt="htpVgg wreut://dFürt=om4871ym+xml" t327ileo Galilei">Galileo Ga7>
e-4SicherhpVgg Unterhach/ng"htpVgg Unterhach/ngom4871ym+xml" t60al Mubarak">Gamal Mubarakr7na>">/" e<' />28une-inem-2Schule allg.-4kr7na-4Sicherhpyk//dCarttp:pyk//dCartom4871ym+xml" t60al Mubarak">Gamal Mubarak5.urg im Üechtl844ibe-inem-2Siegfried undk57tsbarkeit-4rebren.waiacrebren.waom4871ym+xml" t60al Mubarak">Gamal Mubarakre mittelherstel726ee-inem-2Sendai-4Senda60e mō Aberefriltpkyte PscMilitär://de.wiriltpkyte PscMilitär://dem741"m+xml" tGa831n Politik">Gabun Politik0ermittelherstel681ee-inem-2Sicherheit-4Sk0ermō Aberefrictu.r.wirictu.rom4871ym+xml" t327ileo Galilei">Galileo Ga64na>">/" e<' />556ale-inem-2Sicherheitsla64naō AberefSETI-ExpresswikSETI-Expressm741"m+xml" tGa4697isbre Politik">Gambisbr3 olitikrna>">/4195ie-inem-2Selig"nstadt-r3 aō AberefSWwikSWom4871ym+xml" t3505isbre Politik">Gambisbr38Politikrna>">/130ale-inem-2Schliersee-4Sr38Poō Abereft Andrews (ttpot.wiki)"htt Andrews (ttpot.wiki)om4871ym+xml" t92ermittelhersteller">Fu406urg im Üechtl225ibe-inem-2Science-Fictir06urō Abereft. Galcee.wit. Galceem741"m+xml" tGa919ileo Galilei">Galileo Gal9rmittelherstel924ie-inem-2Shinagawa-4Shil9rmō Abereft. Galcee (Kanton)hret. Galcee (Kanton)om4871ym+xml" t3505isbre Politik">Gambisbrerna>">/" e<' />7830ne-inem-2Sevim Dağdel35rnaerhref="ht. Georg:n imtttp:arzwaldhret. Georg:n imtttp:arzwaldom4871ym+xml" t92ermittelhersteller">Futtrna>">/" e<' />4270ne-inem-2Schweich-4Schr27naerhref="ht. Inkiacthret. Inkiactm741"m+xml" tGa196bisbre Politik">Gambisbre Politikrna>">/9651ie-inem-2Sensors Unlimt9 Pollnationat. Jean d'Areflyhret. Jean d'Arefly://de.wikiactu.co80n Politik">Gabun Politi06Politikrna>">/2778ie-inem-2Schuhindustrii06Pollnationat. Lou//de.t. Lou//m741"m+xml" tGa817ball-Bundesliga dt. al763 olitikrna>">/4195ie-inem-2Selig"nstadt-763 ollnationat. Moringsget. Moringom4871ym+xml" t513isbre Politik">Gambisbre Politikrna>">/9651ie-inem-2Sensors Unlime Pollnationat. Nikl/de.nwikt. Nikl/de.nm741"m+xml" tGa986iburg im Üechtland">FreiiPolitikrna>">/2778ie-inem-2SchuhindustrieiiPollnationat. Peter amiactthret. Peter amiacttm741"m+xml" tGa7787isbre Politik">Gambisbrt>Politikrna>">/2778ie-inem-2Schuhindustrirt>Pollnationat. Pölt.nwikt. Pölt.nm741"m+xml" tGa7787isbre Politik">Gambisbr2rna>">/" e<' />8750le-inem-2Sergio Garcír2rnallnationat. Pölt.n (regisyte)wikt. Pölt.n (regisyte)m741"m+xml" tGa844iburg im Üechtland">Fre97rmittelherstel681ee-inem-2Sicherheit-4Sk97rmō Abereft. Wendeliñt. Wendelm741"m+xml" tGa4697isbre Politik">Gambisbr3rna>">/" e<' />8750le-inem-2Sergio Garcí435naeilbahnvetaatltp:/ Univikiität Tifl//de.taatltp:/ Univikiität Tifl//m741"m+xml" tGa186ermittelhersteller">Futi Politikrna>">/130ale-inem-2Schliersee-4Sc20na">/" e<' taats-iactuVerferde.w//de.wiktaats-iactuVerferde.w//de.om4871ym+xml" t92ermittelhersteller">Fu40rPolitikrna>">/9191ie-inem-2Senegalesisyt404Sigmar Gabrtaats-Univikiität /de.North Carolnra//dtaats-Univikiität /de.North Carolnraom4871ym+xml" t9091isbre Politik">Gambisbr59rmittelherstel924ie-inem-2Shinagawa-4Shi59rmō Abereftaatsarefhörigk/derüfungsgetaatsarefhörigk/derüfung://de.wikiactu.co80n Politik">Gabun Politikrna>">/" e<' />85i0ne-inem-2Sergei Lawrowikrnaō Abereftaatsarwaltballn Münctun Isgetaatsarwaltballn Münctun Iom4871ym+xml" t9091isbre Politik">Gambisbr7burg im Üechtl8456be-inem-2Shannon Lucidr7burō Abereftaatsarwaltballn Wiwn.witaatsarwaltballn Wiwn://de.wikiactu.co80n Politik">Gabun Politikrurg im Üechtl986ibe-inem-2Sherpa Associ52immerhref="htaats//de.wiktaats//de.om4871ym+xml" t92ermittelhersteller">Fu87Politikrna>">/2778ie-inem-2Schuhindustri87Poerhref="htaatsbaungsgetaatsbaungom4871ym+xml" t92ermittelhersteller">Fu88>Politikrna>">/254bie-inem-2SC Freiburg-488>Poerhref="htaatstcodf="httaatstcodf=om4871ym+xml" t92ermittelhersteller">Fu856urg im Üechtl225ibe-inem-2Science-Ficti856urerhref="htabilo"httabiloom4871ym+xml" t513isbre Politik">Gambisbre Politikrna>">/2778ie-inem-2Schuhindustrii1Poerhref="htadee.wtadem741"m+xml" tGa7787isbre Politik">Gambisbr27rmittelherstel681ee-inem-2Sicherheit-4S72ermf="http:/tadltp://dtadltp:m741"m+xml" tGa186ermittelhersteller">Fut82Politikrna>">/391bie-inem-2Siberia Airlit82Pof="http:/tadt der We.wikiactu.wiktadt der We.wikiactu.m741"m+xml" tGa186ermittelhersteller">Fut4rna>">/" e<' />955ale-inem-2Siad Barré-41453of="http:/tadtbahnwiktadtbahnom4871ym+xml" t92ermittelhersteller">Futtr mittelherstel726ee-inem-2Sendai-4Sendartr mf="http:/tadtrodawiktadtrodaom4871ym+xml" t3505isbre Politik">Gambisbr27na>">/" e<' />28une-inem-2Schule allg.-4r27naf="http:/tahlunternehmwn.witahlunternehmwnom4871ym+xml" t6633isbre Politik">Gambisbrerna>">/" e<' />8750le-inem-2Sergio Garcík65naeilbahnvetain/de.tain/om4871ym+xml" t3505isbre Politik">Gambisbr3lPolitikrna>">/9191ie-inem-2Senegalesisytr3lPoeilbahnvetallpflide.wiktallpflide.om4871ym+xml" t6633isbre Politik">Gambisbr25Politikrna>">/2778ie-inem-2Schuhindustrir25Poeilbahnvetandard & Poor'/de.tandard & Poor'/m741"m+xml" tGa7787isbre Politik">Gambisbr02rmittelherstel924ie-inem-2Shinagawa-4Shr024oeilbahnvetandgco.wikiñtandgco.wikom4871ym+xml" t92ermittelhersteller">Fu48 Politikrna>">/9651ie-inem-2Sensors Unlim48 Poeilbahnvetanford (Kalifornsen)iñtanford (Kalifornsen)om4871ym+xml" t92ermittelhersteller">Fu440na>">/" e<' />4270ne-inem-2Schweich-4Sch440naeilbahnvetanford-Univikiitätiñtanford-Univikiitätom4871ym+xml" t92ermittelhersteller">Fu88rna>">/" e<' />564une-inem-2Shijiazhuang-88rnaeilbahnvetanislaw Lsm.witanislaw Lsm://de.wikiactu.co80n Politik">Gabun Politi63>
eilbahnvetanislaw Mark/low.witanislaw Mark/low://de.wikiactu.co80n Politik">Gabun Politi02Politikrna>">/391bie-inem-2Siberia Airlii02Poeilbahnvetanislaw Tilldf="httanislaw Tilldf=om4871ym+xml" t92ermittelhersteller">Fu856na>">/" e<' />8750le-inem-2Sergio García560oeilbahnvetanisław Dziwisz"httanisław Dziwiszom4871ym+xml" t92ermittelhersteller">Fu88ermittelherstel681ee-inem-2Sicherheit-4Sk814oeilbahnvetan/de.tan/m741"m+xml" tGa7787isbre Politik">GambisbrrPolitikrna>">/9191ie-inem-2Senegalesisyt74Sigmar Gabrtar One C2de.tar One C2om4871ym+xml" t60al Mubarak">Gamal Mubarake Politikrna>">/5557ie-inem-2Sigi Harreis-r957igmar Gabrtar Tourtp:tar Tourom4871ym+xml" t60al Mubarak">Gamal Mubarak3rna>">/" e<' />4820ne-inem-2Sevilla-4Sevik3rnagmar Gabrtar Warttp:tar Wartm741"m+xml" tGa817ball-Bundesliga dt. all.rmittelherstel681ee-inem-2Sicherheit-4Sk64oeilbahnvetarchaser Indu//diettp:tarchaser Indu//diet://de.wikiactu.co80n Politik">Gabun Polit2r.">Fußball-Bun7965ie-inem-2Sexuelle Bel236 mf="http:/tarkr.wikiactarkr.wik://de.wikiactu.co80n Politik">Gabun Polit21rna>">/" e<' />564une-inem-2Shijiazhuang-21rnaf="http:/tarnergref=tarnergrm741"m+xml" tGa271ileo Galilei">Galileo Ga7ileirna>">/" e<327ile-inem-2Selenia-4Selea7ilef="http:/tatistyte PscBundesamtiñtatistyte PscBundesamtom4871ym+xml" t327ileo Galilei">Galileo Ga6rna>">/" e<' />7830ne-inem-2Sevim Dağdel3ernaf="http:/taudamm.witaudamm://de.wikiactu.co80n Politik">Gabun Politil Politikrna>">/634le-inem-2Sestriere-4Ses5l Pobarkeit-4taudammbruf="httaudammbruf=m741"m+xml" tGa9651isbre Politik">Gambisbr4na>">/" e<' />955ale-inem-2Siad Barré-4943of="http:/taugebuede.wtaugebuedm741"m+xml" tGa4697isbre Politik">Gambisbr7/" e<' />> Gabun Politilrna>">/" e<' />8750le-inem-2Sergio Garcíilrnaf="http:/tefaniactnhard Ettp:/tefaniactnhard Ettom4871ym+xml" t391bisbre Politik">Gambisbre8leirna>">/" e<769ile-inem-2Shetlandinsel398lee-4Sicheltefaniaöhmwrp:/tefaniaöhmwrom4871ym+xml" t60al Mubarak">Gamal Mubarak5>>
> e-4SicheltefaniMappusp:/tefaniMappusm741"m+xml" tGa7787isbre Politik">Gambisbr52rmittelherstel924ie-inem-2Shinagawa-4Shr524oeilbahnvetefaniMörs//de.witefaniMörs//dem741"m+xml" tGa293dez">Gardezrna>">/" e<' /lPolitikrna>">/9191ie-inem-2Senegalesisyt2e 1trahref="htefaniRaab.witefaniRaab://de.wikiactu.co80n Politik">Gabun Polit2r9Politikrna>">/254bie-inem-2SC Freiburg-4Sr9Porahref="htefaniSchumap://.witefaniSchumap://om4871ym+xml" t327ileo Galilei">Galileo Ga67na>">/" e<' />28une-inem-2Schule allg.-4r671trahref="htefaniaiaclmoudoiactefaniaiaclmoudom741"m+xml" tGa817ball-Bundesliga dt. all4rna>">/" e<' />28une-inem-2Schule allg.-4l4rnarahref="hteffi Lsmkeiacteffi Lsmkeom4871ym+xml" t92ermittelhersteller">Futt8Politikrna>">/130ale-inem-2Schliersee-4Stt8Porahref="hteffi Nco.usp:/teffi Nco.usom4871ym+xml" t92ermittelhersteller">Fu44lurg im Üechtl944ibe-inem-2Severino Bott44lurrahref="hteinikiacteinikm741"m+xml" tGa7787isbre Politik">Gambisbr5rna>">/" e<' />7710ne-inem-2Seilbahnverker5rnarahref="hteinh/de.n ZGiacteinh/de.n ZGom4871ym+xml" t92ermittelhersteller">Fu465Politikrna>">/254bie-inem-2SC Freiburg-4465e>">/" e<' t/dnigde."htt/dnigde.om4871ym+xml" t327ileo Galilei">Galileo Ga0 Politikrna>">/196bie-inem-2Sicherheitsür06e>">/" e<' t/dnz/de.wit/dnz/deom4871ym+xml" t92ermittelhersteller">Futt8Politikrna>">/196bie-inem-2Sicherheitsütt8Po">/" e<' t/lios Haji-Ioannou.wit/lios Haji-Ioannouom4871ym+xml" t60al Mubarak">Gamal Mubarak34" e<' />> /" e<' t/lzenergref=t/lzenergrm741"m+xml" tGa817ball-Bundesliga dt. al769Politikrna>">/130ale-inem-2Schliersee-4S769Po">/" e<' t/phaniHolthoff-Pförtn//.witephaniHolthoff-Pförtn//m741"m+xml" tGa7787isbre Politik">Gambisbr0e>
/" e<' t/phaniKram//.witephaniKram//om4871ym+xml" t327ileo Galilei">Galileo Ga6rleirna>">/" e<769ile-inem-2Shetlandinsel363 ollnationatéphanie /de.Monacoiactéphanie /de.Monacoom4871ym+xml" t513isbre Politik">Gambisbre45Politikrna>">/254bie-inem-2SC Freiburg-4e45Po">/" e<' t/phen Harp//.witephen Harp//m741"m+xml" tGa9651isbre Politik">Gambisbr42Politikrna>">/391bie-inem-2Siberia Airlir42Po">/" e<' t/phen Keshi.witephen Keshim741"m+xml" tGa831n Politik">Gabun Politik0na>">/" e<' />8750le-inem-2Sergio García0naeilbahnvetephen Robinson.witephen Robinsonom4871ym+xml" t327ileo Galilei">Galileo Ga6rurg im Üechtl438ibe-inem-2Schwerin-4Schr63urrahref="hterbehilfe.witerbehilfem741"m+xml" tGa817ball-Bundesliga dt. all4.rmittelherstel681ee-inem-2Sicherheit-4Sk464oeilbahnveTEREO.wiTEREOom4871ym+xml" t327ileo Galilei">Galileo Ga7eleirna>">/" e<327ile-inem-2Selenia-4Selen75lee-4Sichelteuerhinterziehde."htt/uerhinterziehde.m741"m+xml" tGa186ermittelhersteller">Fut8rurg im Üechtl438ibe-inem-2Schwerin-4Sch183urrahref="hteuerolitikref=teuerolitikrm741"m+xml" tGa7787isbre Politik">Gambisbr7.>
rahref="hteuer//de.wikteuer//de.://de.wikiactu.co80n Politik">Gabun Polit213" e<' />> Frei7Politikrna>">/2778ie-inem-2Schuhindustri987Poerhref="hteve Irvinwikteve Irvinom4871ym+xml" t6633isbre Politik">Gambisbreurg im Üechtl844ibe-inem-2Siegfried undk6urerhref="hteve Jobswikteve Jobsm741"m+xml" tGa986iburg im Üechtland">Fre9/" e<' />> Futt2Politikrna>">/391bie-inem-2Siberia Airlir22Po">/" e<' t/ven Soderbergh.witeven Soderberghom4871ym+xml" t391bisbre Politik">Gambisbre>>
> ">/" e<' t/ven Spttpbcog.witeven Spttpbcogm741"m+xml" tGa817ball-Bundesliga dt. all4iPolitikrna>">/2778ie-inem-2Schuhindustril4iPo">/" e<' tiftde."httiftde.m741"m+xml" tGa7787isbre Politik">Gambisbrr/" e<' />> /" e<' tiftde. Preußyte Pr Kulturbesingsgetiftde. Preußyte Pr Kulturbesingom4871ym+xml" t3505isbre Politik">Gambisbr3 Politikrna>">/1705ie-inem-2Sharm El-Sheia36 mf="http:/tiftde. Waikntestsgetiftde. Waikntestm741"m+xml" tGa919ileo Galilei">Galileo GallPolitikrna>">/9191ie-inem-2Senegalesisyte 1narahref="htref="."httief=".om4871ym+xml" t513isbre Politik">Gambisbree>>
> ">/" e<' tjepaniMesic"httjepaniMesicm741"m+xml" tGa7787isbre Politik">Gambisbr4/leirna>">/" e<327ile-inem-2Selenia-4Sele74ilehmerzensgtockerau.witockeraum741"m+xml" tGa196bisbre Politik">Gambisbre rmittelherstel681ee-inem-2Sicherheit-4Sre rmhmerzensgtockheim (Obcof.wiken)iñtockheim (Obcof.wiken)m741"m+xml" tGa4697isbre Politik">Gambisbr3a>">/" e<' />8750le-inem-2Sergio Garcí43mhmerzensgtockholmiñtockholmm741"m+xml" tGa831n Politik">Gabun Politik0nrmittelherstel681ee-inem-2Sicherheit-4Sk00rmhmerzensgtopbcog (Rhld.)iñtopbcog (Rhld.)om4871ym+xml" t60al Mubarak">Gamal Mubarak3 Politikrna>">/9651ie-inem-2Sensors Unlimk3 Pohmerzensgtorf="httorf=m741"m+xml" tGa7787isbre Politik">Gambisbr52" e<' />> /" e<' torkau (Epbc)iñtorkau (Epbc)om4871ym+xml" t60al Mubarak">Gamal Mubarak5>Politikrna>">/9651ie-inem-2Sensors Unlimk5 Pohmerzensgtörde. der R/ligisysausübde."httörde. der R/ligisysausübde.om4871ym+xml" t513isbre Politik">Gambisbree urg im Üechtl944ibe-inem-2Severino Bott55nref="http:/törde. der Totenruhe"httörde. der Totenruheom4871ym+xml" t92ermittelhersteller">Fu87u>
f="http:/törde. des öffkntltp:/n e.wikins durf= Androhde. /de.Straftatikiactörde. des öffkntltp:/n e.wikins durf= Androhde. /de.Straftatikm741"m+xml" tGa196bisbre Politik">Gambisbr31na>">/" e<' />785ale-inem-2Sexten-4Sexter31naf="http:/traf//de.wiktraf//de.om4871ym+xml" t92ermittelhersteller">Fu88mittelherstel681ee-inem-2Sicherheit-4Sk8af="http:/traftat allg..witraftat allg.m741"m+xml" tGa817ball-Bundesliga dt. al71>>
> f="http:/traftat Datikverän://de."httraftat Datikverän://de.om4871ym+xml" t6633isbre Politik">Gambisbreuurg im Üechtl844ibe-inem-2Siegfried undk6u2 f="http:/traftat naf= dtiktprengstoffüfungsgetraftat naf= dtiktprengstoffüfungm741"m+xml" tGa844iburg im Üechtland">Fre9 Politikrna>">/130ale-inem-2Schliersee-4Se9 Pof="http:/trahlenk.wikh/de.witrahlenk.wikh/dem741"m+xml" tGa817ball-Bundesliga dt. all4>>
> f="http:/tralsup://dtralsup:om4871ym+xml" t9091isbre Politik">Gambisbr5rleirna>">/" e<769ile-inem-2Shetlandinselr5rlef="http:/trategschaftUmweltprüfde."httrategschaftUmweltprüfde.om4871ym+xml" t6633isbre Politik">Gambisbr72na>">/" e<' />556ale-inem-2Sicherheitslk72naf="http:/trategschafr Rohstoff"httrategschafr Rohstoffom4871ym+xml" t60al Mubarak">Gamal Mubarakeileirna>">/" e<327ile-inem-2Selenia-4Selekeilef="http:/tratfor"httratform741"m+xml" tGa4697isbre Politik">Gambisbr7.>
rahref="htraubie."httraubie.om4871ym+xml" t60al Mubarak">Gamal Mubarakrna>">/" e<' />8750le-inem-2Sergio Garcíkr0 rahref="htraßde.wikitraßde.wom4871ym+xml" t3505isbre Politik">Gambisbrl.rmittelherstel681ee-inem-2Sicherheit-4S3k64oeilbahnvetraßenbahnwiktraßenbahnm741"m+xml" tGa9651isbre Politik">Gambisbr4rmittelherstel900ee-inem-2Seerecht-4Seer44oeilbahnvetraßenbauwiktraßenbaum741"m+xml" tGa196bisbre Politik">Gambisb86r mittelherstel726ee-inem-2Sendai-4Senda86r meilbahnvetraßenradspo/de.wtraßenradspo/dom4871ym+xml" t92ermittelhersteller">Fu88 mittelherstel726ee-inem-2Sendai-4Senda88 meilbahnvetraßenverkehre.wtraßenverkehrom4871ym+xml" t3505isbre Politik">Gambisbr2 Politikrna>">/634le-inem-2Sestriere-4Sesr2 Poeilbahnvetraßenverkehrsordnde."httraßenverkehrsordnde.om4871ym+xml" t6633isbre Politik">Gambisbr7>
> f="http:/trekref=trekrm741"m+xml" tGa196bisbre Politik">Gambisbr mittelherstel726ee-inem-2Sendai-4Sendat5 f="http:/trektkräfte der V://dnigten Staatikiactrektkräfte der V://dnigten Staatikom4871ym+xml" t6633isbre Politik">Gambisbr2Politikrna>">/9651ie-inem-2Sensors Unlimk21 f="http:/trektkräfte /de.Moldawiikiactrektkräfte /de.Moldawiikom4871ym+xml" t513isbre Politik">Gambisbree4" e<' />> Gabun Polit21.">Fußball-Bun7965ie-inem-2Sexuelle Bel216 mf="http:/tromausfalltp:tromausfallom4871ym+xml" t9091isbre Politik">Gambisbr.ileirna>">/" e<916ile-inem-2Sebastian Deis6ileeilbahnveT.wikTcom4871ym+xml" t9091isbre Politik">Gambisb38burg im Üechtl438ibe-inem-2Schwerin-4Schr8bureilbahnveTSuti wikTcuti om4871ym+xml" t92ermittelhersteller">Fu8rna>">/" e<' />4820ne-inem-2Sevilla-4Sevi8rnagmar GabrTcuti2wikTcuti2om4871ym+xml" t327ileo Galilei">Galileo Ga44Politikrna>">/196bie-inem-2Sicherheitsür44Pogmar GabrTcuti3wikTcuti3://de.wikiactu.co80n Politik">Gabun Politi0rna>">/" e<' />955ale-inem-2Siad Barré-4i0rnagmar GabrTcuti4wikTcuti4om4871ym+xml" t60al Mubarak">Gamal Mubarakr5 mittelherstel726ee-inem-2Sendai-4Senda6055agmar GabrTcut3 wikTcut3 om4871ym+xml" t92ermittelhersteller">Fu68eurg im Üechtl844ibe-inem-2Siegfried undk86ureilbahnveTSut33wikTcut33://de.wikiactu.co80n Politik">Gabun Polit41burg im Üechtl944ibe-inem-2Severino Bott41burf="http:/tuart Baxt//.wituart Baxt//om4871ym+xml" t327ileo Galilei">Galileo Ga7.">Fußball-Bun805ie-inem-2Shenzhouprogra3r0Pof="http:/tudkntenverbiedde."httudkntenverbiedde.om4871ym+xml" t3505isbre Politik">Gambisbr2na>">/" e<' />28une-inem-2Schule allg.-4r21of="http:/tudie"httudieom4871ym+xml" t9091isbre Politik">Gambisb12rna>">/" e<' />955ale-inem-2Siad Barré-41253of="http:/tudiengebühre.wtudiengebühr://de.wikiactu.co80n Politik">Gabun Polit41>>
> f="http:/tudiosusp:/tudiosusom4871ym+xml" t60al Mubarak">Gamal Mubarak3lPolitikrna>">/9191ie-inem-2Senegalesisyt63lPoeilbahnvetudiump:/tudiumm741"m+xml" tGa831n Politik">Gabun Politi7e Politikrna>">/2778ie-inem-2Schuhindustri7i1Poerhref="htu//.witu//m741"m+xml" tGa9651isbre Politik">Gambisbr3e>
erhref="htuhre.wtuhr://de.wikiactu.co80n Politik">Gabun Polit1 Politikrna>">/904be-inem-2SG Kronau/Ös14Pof="http:/turmp:/turmm741"m+xml" tGa831n Politik">Gabun Politir3e" e<' />> Gabun Polit1 rmittelherstel681ee-inem-2Sicherheit-4Sr44oeilbahnveturmiactwikiacturmiactwik://de.wikiactu.co80n Politik">Gabun Polit11rna>">/" e<' />85i0ne-inem-2Sergei Lawrow11rnaeilbahnvetuttgctthretuttgctt://de.wikiactu.co80n Politik">Gabun Polit2ermittelherstel568ee-inem-2Scientology-4284aeilbahnvetuttgctt (regisyte)wiktuttgctt (regisyte)om4871ym+xml" t9091isbre Politik">Gambisb12 Politikrna>">/391bie-inem-2Siberia Airli12 Pof="http:/tützerbaf="httützerbaf=://de.wikiactu.co80n Politik">Gabun Politike>
f="http:/ubaruwikubarum741"m+xml" tGa919ileo Galilei">Galileo Galrna>">/" e<' />7830ne-inem-2Sevim Dağdelalrnaf="http:/ubventisyskürzde."htubventisyskürzde.om4871ym+xml" t6633isbre Politik">Gambisbrena>">/" e<' />8750le-inem-2Sergio Garcík6naf="http:/uchmasch/ne allg..wiuchmasch/ne allg.om4871ym+xml" t60al Mubarak">Gamal Mubarake urg im Üechtl944ibe-inem-2Severino Bottke urf="http:/uchoi.wiuchoim741"m+xml" tGa831n Politik">Gabun Politi7r9Politikrna>">/254bie-inem-2SC Freiburg-47r9Porahref="huwikiñuwikm741"m+xml" tGa293dez">Gardezrna>">/" e<'8rn8mittelherstel681ee-inem-2Sicherheit-4Sk2/" witsch Kruwikforbaue."htuwikforbaue.om4871ym+xml" t92ermittelhersteller">Fu857Politikrna>">/2778ie-inem-2Schuhindustri857Poerhref="hüd-Thürnref=-Bahnwiküd-Thürnref=-Bahn://de.wikiactu.co80n Politik">Gabun Polit41uurg im Üechtl844ibe-inem-2Siegfried und41uurerhref="hüdafrikanschaft-4Senegalesisyte Fußballnatiüdafrikanschaft-4Senegalesisyte Fußballnm741"m+xml" tGa4697isbre Politik">Gambisbr7iPolitikrna>">/2778ie-inem-2Schuhindustrir7iPoerhref="hüdamco.kanschaftNesisyengem/insballn CSNatiüdamco.kanschaftNesisyengem/insballn CSN://de.wikiactu.co80n Politik">Gabun Politilrna>">/" e<' />85i0ne-inem-2Sergei Lawrowi7rnaeilbahnveudanwikudanm741"m+xml" tGa7787isbre Politik">Gambisbr08Politikrna>">/196bie-inem-2Sicherheitsür08Poerhref="hüddeude.we Zeitde."htüddeude.we Zeitde.m741"m+xml" tGa271ileo Galilei">Galileo Ga7 rmittelherstel681ee-inem-2Sicherheit-4Sa7 rmerhref="hüdkoreanschaft-4Senegalesisyte Fußballnatiüdkoreanschaft-4Senegalesisyte Fußballnm741"m+xml" tGa831n Politik">Gabun Politir3 rmittelherstel681ee-inem-2Sicherheit-4Sr3 rmerhref="hüdkoreanschaftPerssyteie"htüdkoreanschaftPerssyteieom4871ym+xml" t60al Mubarak">Gamal Mubarak1rna>">/" e<' />5e>">/" e<' />5e>">/" e<' k1rnaerhref="hüdkoreanschafscMilitär://de.wiüdkoreanschafscMilitär://de://de.wikiactu.co80n Politik">Gabun Polit2e9rmittelherstel924ie-inem-2Shinagawa-4Sh2e9rmerhref="hüdltp:/r Ozeae.wiüdltp:/r Ozeae://de.wikiactu.co80n Politik">Gabun Politi8rna>">/" e<' />4270ne-inem-2Schweich-4Schi8rnaerhref="hüdlohnwiküdlohn://de.wikiactu.co80n Politik">Gabun Politi3ileirna>">/" e<504ile-inem-2Siegen-4Siegen349ehmerzensgüdossetide.wiüdossetideom4871ym+xml" t9091isbre Politik">Gambisb17rurg im Üechtl438ibe-inem-2Schwerin-4Sch173urerhref="hüdtirol.wiüdtirolom4871ym+xml" t9091isbre Politik">Gambisbr52 mittelherstel726ee-inem-2Sendai-4Sendar52 meilbahnveuffolk (Virginia)wikuffolk (Virginia)://de.wikiactu.co80n Politik">Gabun Polit22rna>">/" e<' />955ale-inem-2Siad Barré-42253of="http:/uhl.wiuhlom4871ym+xml" t3505isbre Politik">GambisbrePolitikrna>">/1705ie-inem-2Sharm El-Sheia1 meilbahnveuizi://duizi:om4871ym+xml" t9091isbre Politik">Gambisbr. Politikrna>">/1337ie-inem-2Sicherungshafr. Poeilbahnveulei Fuija="htulei Fuija=m741"m+xml" tGa831n Politik">Gabun Politir3u>
eilbahnveulzbaf=tikiaculzbaf=tikom4871ym+xml" t6633isbre Politik">Gambisbr20urg im Üechtl844ibe-inem-2Siegfried und6k0urf="http:/umatrawikumatraom4871ym+xml" t9091isbre Politik">Gambisb16rna>">/" e<' />556ale-inem-2Sicherheitsl16rnaf="http:/umba (Indsyessen)iñumba (Indsyessen)://de.wikiactu.co80n Politik">Gabun Polit41e" e<' />> Gambisbr. rmittelherstel681ee-inem-2Sicherheit-4Sr6 rmerhref="humner R/dstonewikumner R/dstone://de.wikiactu.co80n Politik">Gabun Polit21lurg im Üechtl944ibe-inem-2Severino Bott2n92t-4Sicherhun Laiyanwikun Laiyanm741"m+xml" tGa831n Politik">Gabun Politir3 Politikrna>">/4195ie-inem-2Selig"nstadt-93 Poeilbahnvede.ai Kolokwikun.ai Kolokom4871ym+xml" t327ileo Galilei">Galileo Ga03" e<' />> Gabun Polit22r mittelherstel726ee-inem-2Sendai-4Senda2tr mf="http:/unnyvaceatiunnyvacem741"m+xml" tGa986iburg im Üechtland">Freirna>">/" e<' />955ale-inem-2Siad Barré-4eirnaf="http:/unsh/ne Coastsgeunsh/ne Coastom4871ym+xml" t3505isbre Politik">Gambisbr3Politikrna>">/634le-inem-2Sestriere-4Sesr Poeilbahnveuper RTLsgeuper RTL://de.wikiactu.co80n Politik">Gabun Polit4klurg im Üechtl944ibe-inem-2Severino Bott429urllnationaurab No.aideli.wiurab No.aideliom4871ym+xml" t3505isbre Politik">Gambisbr5iPolitikrna>">/2778ie-inem-2Schuhindustrir5iPollnationaurab ttp:ania.wiurab ttp:aniam741"m+xml" tGa7787isbre Politik">Gambisbr77Politikrna>">/2778ie-inem-2Schuhindustrir77Pollnationaurabaya.wiurabaya://de.wikiactu.co80n Politik">Gabun Politi10Politikrna>">/583ale-inem-2SES Astra-4SES1 Pof="http:/urakarta.wiurakartaom4871ym+xml" t92ermittelhersteller">Fu46rna>">/" e<' />4270ne-inem-2Schweich-4Schr6rnaerhref="hurayud Chulanont.wiurayud Chulanont://de.wikiactu.co80n Politik">Gabun Polit11 Politikrna>">/391bie-inem-2Siberia Airli11 Pof="http:/urrey.wiurrey://de.wikiactu.co80n Politik">Gabun Polit244na>">/" e<' />2760ne-inem-2Schipkau-4Sch244naf="http:/usFue Alb//de.wikusFue Alb//de.m741"m+xml" tGa196bisbre Politik">Gambisb866na>">/" e<' />8750le-inem-2Sergio Garcíak6naf="http:/usFue Kastn//.wiusFue Kastn//m741"m+xml" tGa844iburg im Üechtland">Fre97Politikrna>">/130ale-inem-2Schliersee-4Se973rerhref="hü.wPiñü.wP://de.wikiactu.co80n Politik">Gabun Politi8urg im Üechtl944ibe-inem-2Severino Bott5bureilbahnveusilo Bambang Yudhoyono.wiusilo Bambang Yudhoyonom741"m+xml" tGa844iburg im Üechtland">Fre9>Politikrna>">/9651ie-inem-2Sensors Unlime9>Poeilbahnveussex.wiussexom4871ym+xml" t60al Mubarak">Gamal Mubarak3" e<' />> Gabun Polit21r3a>">/" e<' />8750le-inem-2Sergio Garcí21r3allnationauzhou (Jiangsu)iñuzhou (Jiangsu)m741"m+xml" tGa844iburg im Üechtland">Fre399mittelherstel568ee-inem-2Scientology-4k399mllnationauzuka.wiuzuka://de.wikiactu.co80n Politik">Gabun Politik4Politikrna>">/196bie-inem-2Sicherheitsüik4Pollnationauzuki.wiuzukiom4871ym+xml" t3505isbre Politik">Gambisb905urg im Üechtl225ibe-inem-2Science-Ficti905urllnationaV Babelsbcog 0PolaV Babelsbcog 0Pom4871ym+xml" t92ermittelhersteller">Fu870Politikrna>">/9191ie-inem-2Senegalesisyt870PollnationaV Wacker Burgh/de.nwikV Wacker Burgh/de.nm741"m+xml" tGa831n Politik">Gabun Politir3u" e<' />> /" e<' ven Fschafrwikven Fschafrom4871ym+xml" t60al Mubarak">Gamal Mubarake.Politikrna>">/254bie-inem-2SC Freiburg-46/ Pohiffsverkven Hannawaldhreven Hannawaldm741"m+xml" tGa831n Politik">Gabun Politir3rna>">/" e<' />7830ne-inem-2Sevim Dağdela3rnaf="http:/ven R.wikfrwikven R.wikfrm741"m+xml" tGa293dez">Gardezrna>">/" e<'8r4na>">/" e<' />2760ne-inem-2Schipkau-4Sch8r4naf="http:/veriges Riksbankwikveriges Riksbank://de.wikiactu.co80n Politik">Gabun Politi65Politikrna>">/254bie-inem-2SC Freiburg-4565e>">/" e<' veriges Televis"http:veriges Televis"htom4871ym+xml" t92ermittelhersteller">Fu46 Politikrna>">/904be-inem-2SG Kronau/Ös46 Po">/" e<' verre Magnus /de.Norw.wikiacverre Magnus /de.Norw.wikom4871ym+xml" t60al Mubarak">Gamal Mubarak5uurg im Üechtl844ibe-inem-2Siegfried undk5uurerhref="hveti Rokwikveti Rok://de.wikiactu.co80n Politik">Gabun Polit22 Politikrna>">/904be-inem-2SG Kronau/Ös22 PollnationaVPwikVPom4871ym+xml" t92ermittelhersteller">Fu49.rmittelherstel681ee-inem-2Sicherheit-4S49.rmllnationa:antjeiactt Fuwik:antjeiactt Fuom4871ym+xml" t60al Mubarak">Gamal Mubarake Politikrna>">/4195ie-inem-2Selig"nstadt-ke PollnationaWARMwikWARMom4871ym+xml" t92ermittelhersteller">Fu44iPolitikrna>">/2778ie-inem-2Schuhindustri44iPollnationa:e.wika Irekowka Ichamuratowa.wi:e.wika Irekowka Ichamuratowaom4871ym+xml" t327ileo Galilei">Galileo Ga44olitikrna>">/196bie-inem-2Sicherheitsür44ollnationaWFwikWFom4871ym+xml" t60al Mubarak">Gamal Mubarake >
> ">/" e<' wife.wiwifem741"m+xml" tGa271ileo Galilei">Galileo G790>
">/" e<' wie."htwie.om4871ym+xml" t60al Mubarak">Gamal Mubara32rna>">/" e<' />4820ne-inem-2Sevilla-4Sevi32rna">/" e<' wisswikwissm741"m+xml" tGa196bisbre Politik">Gambisbr39Politikrna>">/130ale-inem-2Schliersee-4Sr39Po">/" e<' wissairwikwissairm741"m+xml" tGa817ball-Bundesliga dt. al71>
o">/" e<' ydney.wiydneym741"m+xml" tGa831n Politik">Gabun Politi7r Politikrna>">/391bie-inem-2Siberia Airli7r Po">/" e<' ykeiacykeom4871ym+xml" t92ermittelhersteller">Futtrna>">/" e<' />564une-inem-2Shijiazhuang-ttrna">/" e<' ylt (Gem/indc)iñylt (Gem/indc)m741"m+xml" tGa4697isbre Politik">Gambisbr39rmittelherstel924ie-inem-2Shinagawa-4Shr39rm">/" e<' ywikyn://de.wikiactu.co80n Politik">Gabun PolitikiPolitikrna>">/2778ie-inem-2SchuhindustriikiPo">/" e<' ychronsprnref="htychronsprnref=om4871ym+xml" t327ileo Galilei">Galileo Ga4.rmittelherstel681ee-inem-2Sicherheit-4S3464oeilbahnveynth Pop"htyth Popom4871ym+xml" t513isbre Politik">Gambisbree0Politikrna>">/583ale-inem-2SES Astra-4SES5 Pof="http:/yphil//de.yphil//m741"m+xml" tGa7787isbre Politik">Gambisbr4/eirna>">/" e<327ile-inem-2Selenia-4Sele74iof="http:/yracde. 3Ade.yracde. 3Am741"m+xml" tGa7787isbre Politik">Gambisbr4>
Gamal Mubarak5r mittelherstel726ee-inem-2Sendai-4Sendak5r mf="http:/yrschafscMilitär://de.wiyrschafscMilitär://deom4871ym+xml" t6633isbre Politik">Gambisbr7>Politikrna>">/254bie-inem-2SC Freiburg-4676e>">/" e<' zczekociny.wizczekocinym741"m+xml" tGa831n Politik">Gabun Politir34/eirna>">/" e<327ile-inem-2Selenia-4Seler34/e">/" e<' z.widhrez.widom4871ym+xml" t6633isbre Politik">Gambisbr7>leirna>">/" e<327ile-inem-2Selenia-4Selek7ileeilbahnveławomir.Nowakwikławomir.Nowakm741"m+xml" tGa831n Politik">Gabun Politir36na>">/" e<' />564une-inem-2Shijiazhuang-t36naeilbahnvT-Mobile Internesisyte AG & Co. KG">T-Mobile Internesisyte AG & Co. KGm741"m+xml" tGa831n Politik">Gabun Politir37>
e-4SicherT-Onl/ne Internesisyte AG">T-Onl/ne Internesisyte AGm741"m+xml" tGa4697isbre Politik">Gambisbr7rna>">/" e<' />4820ne-inem-2Sevilla-4Sevir7rna-4SicherT-Sysbiss">T-Sysbissm741"m+xml" tGa831n Politik">Gabun Politir36rmittelherstel681ee-inem-2Sicherheit-4Sr364oeilbahnvTa MokwiTa Mok://de.wikiactu.co80n Politik">Gabun Polit21ileirna>">/" e<327ile-inem-2Selenia-4Selea1ilef="http:TabakhandeliTabakhandelom4871ym+xml" t9091isbre Politik">Gambisbr. >
f="http:Tabakindu//dieiTabakindu//diem741"m+xml" tGa919ileo Galilei">Galileo GalrPolitikrna>">/4195ie-inem-2Selig"nstadt-91e mō AbereTäby.wTäbyom4871ym+xml" t92ermittelhersteller">Fu85rleirna>">/" e<769ile-inem-2Shetlandinsel85rlef="http:Tacitusp:Tacitusm741"m+xml" tGa271ileo Galilei">Galileo G794Politikrna>">/196bie-inem-2Sicherheitsü794Pof="http:Tacomap:Tacoma://de.wikiactu.co80n Politik">Gabun Polit249Politikrna>">/130ale-inem-2Schliersee-4S249Pof="http:Ta. der Mikiacen//de.eiTa. der Mikiacen//de.em741"m+xml" tGa831n Politik">Gabun Politir36>
f="http:Tagesspi.wiliTagesspi.wilom4871ym+xml" t3505isbre Politik">Gambisb90>Politikrna>">/254bie-inem-2SC Freiburg-4906e>">/" e<'Taha J5isiniRamadanwiTaha J5isiniRamadanom4871ym+xml" t92ermittelhersteller">Fu87 >
">/" e<'TahitiwiTahitiom4871ym+xml" t3505isbre Politik">Gambisbr544olitikrna>">/196bie-inem-2Sicherheitsür544oeilbahnvTaibaue."hTaibaue.om4871ym+xml" t3505isbre Politik">Gambisbr90Politikrna>">/9191ie-inem-2Senegalesisytr90PoeilbahnvTaifunwiTaifunm741"m+xml" tGa831n Politik">Gabun Politir3/eirna>">/" e<327ile-inem-2Selenia-4Seler30oeilbahnvTaipehwiTaipehom4871ym+xml" t92ermittelhersteller">Fu876na>">/" e<' />564une-inem-2Shijiazhuang-876naeilbahnvTaiisir ChalidhrTaiisir Chalidom4871ym+xml" t92ermittelhersteller">Fu880urg im Üechtl844ibe-inem-2Siegfried und880ureilbahnvTaiwanwiTaiwanom4871ym+xml" t327ileo Galilei">Galileo Ga49rmittelherstel924ie-inem-2Shinagawa-4Sha49rmeilbahnvTaiyunwiTaiyunm741"m+xml" tGa831n Politik">Gabun Politi29 rmittelherstel681ee-inem-2Sicherheit-4S29 rmeilbahnvTaizéwiTaizém741"m+xml" tGa271ileo Galilei">Galileo G79 urg im Üechtl944ibe-inem-2Severino Bott7e urf="http:TaizzwiTaizzm741"m+xml" tGa271ileo Galilei">Galileo G766rmittelherstel681ee-inem-2Sicherheit-4S766rmf="http:Tak (ktadt)iTak (ktadt)://de.wikiactu.co80n Politik">Gabun Politik3/eirna>">/" e<327ile-inem-2Selenia-4Seleik3/ef="http:Takeo FukuiwiTakeo Fukuim741"m+xml" tGa4697isbre Politik">Gambisbr7 urg im Üechtl944ibe-inem-2Severino Bottr7 urf="http:Tae Af.r.wTae Af.r://de.wikiactu.co80n Politik">Gabun Polit1 rna>">/" e<' />7710ne-inem-2Seilbahnverke1 rnaf="http:TaeibanwiTaeibanm741"m+xml" tGa7787isbre Politik">Gambisbr42na>">/" e<' />556ale-inem-2Sicherheitslr42naf="http:Taeisay City (Cebu)wiTaeisay City (Cebu)m741"m+xml" tGa986iburg im Üechtland">Frei6rmittelherstel681ee-inem-2Sicherheit-4Sr86rmf="http:Tallaboap:Tallaboaom4871ym+xml" t513isbre Politik">Gambisbree3/eirna>">/" e<327ile-inem-2Selenia-4Selei53/ef="http:Tallahisbeep:Tallahisbeeom4871ym+xml" t327ileo Galilei">Galileo Gar7>
> f="http:TallinnwiTaelinnom4871ym+xml" t60al Mubarak">Gamal Mubarake3/eirna>">/" e<327ile-inem-2Selenia-4Sele6r30oeilbahnvTaloqanwiTaeoqanom4871ym+xml" t9091isbre Politik">Gambisbr.6rmittelherstel681ee-inem-2Sicherheit-4Sr66rmf="http:Tam Ky.wTam Ky://de.wikiactu.co80n Politik">Gabun Polit4kl olitikrna>">/4195ie-inem-2Selig"nstadt-r29lef="http:Tamar Lebanidsep:Tamar Lebanidseom4871ym+xml" t92ermittelhersteller">Fu4944olitikrna>">/196bie-inem-2Sicherheitsü4944oeilbahnvTamil Nadu (Bundesstaat)wiTamil Nadu (Bundesstaat)om4871ym+xml" t92ermittelhersteller">Fu880leirna>">/" e<769ile-inem-2Shetlandinsel880lef="http:Tampap:Tampaom4871ym+xml" t92ermittelhersteller">Fu458 mittelherstel726ee-inem-2Sendai-4Senda458 mf="http:Tanegashimap:Tanegashimam741"m+xml" tGa844iburg im Üechtland">Fre97Politikrna>">/9651ie-inem-2Sensors Unlime97naeilbahnvTarefrmündep:Tarefrmündeom4871ym+xml" t92ermittelhersteller">Fu46.>
f="http:Tanja e.wikinp:Tarja e.wikin://de.wikiactu.co80n Politik">Gabun Polit11rPolitikrna>">/904be-inem-2SG Kronau/Ös1195 f="http:Tanja GönkfrwiTanja Gönkfrm741"m+xml" tGa196bisbre Politik">Gambisb863>
eilbahnvTanja Ir"httpTanja Ir"ht://de.wikiactu.co80n Politik">Gabun Polit1 7>
> f="http:Tankstelceeunternehmwn.wTankstelceeunternehmwnom4871ym+xml" t3505isbre Politik">Gambisbr9 Politikrna>">/1337ie-inem-2Sicherungshafr9 Pof="http:TANStPerú.wTANStPerúm741"m+xml" tGa196bisbre Politik">Gambisbr3 rmittelherstel681ee-inem-2Sicherheit-4Srr44ollnationTänzfrwiTänzfrm741"m+xml" tGa831n Politik">Gabun Politi23eurg im Üechtl844ibe-inem-2Siegfried und23eurf="http:Tanzspo/de.Tanzspo/dm741"m+xml" tGa271ileo Galilei">Galileo G799Politikrna>">/254bie-inem-2SC Freiburg-4799e>">/" e<'Tarcis"h Kardiyte BertonewiTarcis"h Kardiyte Bertone://de.wikiactu.co80n Politik">Gabun Politi6 Politikrna>">/634le-inem-2Sestriere-4Ses5634oeilbahnvTarek Al-WazirwiTarek Al-Wazirm741"m+xml" tGa919ileo Galilei">Galileo Gal2rmittelherstel924ie-inem-2Shinagawa-4Shal2rmllnationTârgu MureșwiTârgu Mureș://de.wikiactu.co80n Politik">Gabun Politi6r3a>">/" e<' />8750le-inem-2Sergio Garcíi6r3aeilbahnvTarifgem/insballn deude.wer Län://wiTarifgem/insballn deude.wer Län://om4871ym+xml" t9091isbre Politik">Gambisb12 Politikrna>">/904be-inem-2SG Kronau/Ös1215aeilbahnvTarifolitikrefTarifolitikr://de.wikiactu.co80n Politik">Gabun Polit2e3Politikrna>">/130ale-inem-2Schliersee-4S2e3PoeilbahnvTarifrunde Öffkntltp:/r DienstefTarifrunde Öffkntltp:/r Dienst://de.wikiactu.co80n Politik">Gabun Politi3lurg im Üechtl944ibe-inem-2Severino Botti3lureilbahnvTarin KutefTarin Kutm741"m+xml" tGa271ileo Galilei">Galileo G781>
o">/" e<'Tarō AsōefTarō Asōom4871ym+xml" t60al Mubarak">Gamal Mubarak5r/eirna>">/" e<327ile-inem-2Selenia-4Sele6570oeilbahnvTartusp:Tartusm741"m+xml" tGa271ileo Galilei">Galileo G436rmittelherstel681ee-inem-2Sicherheit-4S4364oeilbahnvTae.wkentefTae.wkentm741"m+xml" tGa831n Politik">Gabun Politir36leirna>">/" e<916ile-inem-2Sebastian Deis36lef="http:Tas Fuiwn.wTas Fuiwnm741"m+xml" tGa831n Politik">Gabun Politir37/eirna>">/" e<327ile-inem-2Selenia-4Seler370oeilbahnvTas Fuie.wer TeufiliTas Fuie.wer Teufil://de.wikiactu.co80n Politik">Gabun Politi3lPolitikrna>">/9191ie-inem-2Senegalesisyt53lPoeilbahnvTata Motorsp:Tata Motorsm741"m+xml" tGa196bisbre Politik">Gambisb840>
eilbahnvTatarstanp:Tatarstan://de.wikiactu.co80n Politik">Gabun Politi8>>
> eilbahnvTauacenp:Tauacen://de.wikiactu.co80n Politik">Gabun Politi8eleirna>">/" e<327ile-inem-2Selenia-4Selei8eleeilbahnvTaurus XLp:Taurus XLom4871ym+xml" t3505isbre Politik">Gambisbr55urg im Üechtl225ibe-inem-2Science-Fictir55ureilbahnvTaxiunternehmwn.wTaxiunternehmwnm741"m+xml" tGa271ileo Galilei">Galileo G40r3a>">/" e<' />8750le-inem-2Sergio Garcí40r3aeilbahnvTaylor Nelsde.Sofresp:Taylor Nelsde.Sofres://de.wikiactu.co80n Politik">Gabun Politi04>
f="http:TAZ.wTAZm741"m+xml" tGa831n Politik">Gabun Politi238Politikrna>">/196bie-inem-2Sicherheitsü238Pof="http:Teatro alla Scalap:Teatro alla Scalaom4871ym+xml" t9091isbre Politik">Gambisbr.u>
eilbahnvTechnschaft-achhochbaule BerlinwiTechnschaft-achhochbaule Berlin://de.wikiactu.co80n Politik">Gabun Politi8una>">/" e<' />4270ne-inem-2Schweich-4Schi8rna-4SicherTechnschaftHochbaule HaifawiTechnschaftHochbaule Haifaom4871ym+xml" t6633isbre Politik">Gambisbr2.">Fußball-Bun7965ie-inem-2Sexuelle Belr2.">-4SicherTechnschaftUnivikiität BerlinwiTechnschaftUnivikiität Berlinm741"m+xml" tGa817ball-Bundesliga dt. al715 mittelherstel726ee-inem-2Sendai-4Senda715 m-4SicherTechnschaftUnivikiität ChemningsgTechnschaftUnivikiität Chemningm741"m+xml" tGa831n Politik">Gabun Politir3/" e<' />> Gambisbr87Politikrna>">/130ale-inem-2Schliersee-4Sr87Powitsch KTechnschaftUnivikiität GragsgTechnschaftUnivikiität Gragom4871ym+xml" t9091isbre Politik">Gambisb190leirna>">/" e<769ile-inem-2Shetlandinsel190lewitsch KTechnschaftUnivikiität IlmwnauwiTechnschaftUnivikiität Ilmwnaum741"m+xml" tGa7787isbre Politik">Gambisbr47Politikrna>">/130ale-inem-2Schliersee-4Sr47Powitsch KTechnschaftUnivikiität Münacenp:TechnschaftUnivikiität Münacenm741"m+xml" tGa831n Politik">Gabun Politir5eurg im Üechtl844ibe-inem-2Siegfried undr5eurwitsch KTechnschaftUnivikiität Wienp:TechnschaftUnivikiität Wiwnm741"m+xml" tGa831n Politik">Gabun Politi24e>
witsch KTechnop:Technom741"m+xml" tGa844iburg im Üechtland">Fr93 Politikrna>">/904be-inem-2SG Kronau/Ös93 Powitsch KTed DumitruwiTed Dumitru://de.wikiactu.co80n Politik">Gabun Polit21u>
witsch KTed TurkfrwiTed Turkfrom4871ym+xml" t3505isbre Politik">Gambisbr3ileirna>">/" e<327ile-inem-2Selenia-4Seler3ilewitsch KTeféwiTeféom4871ym+xml" t92ermittelhersteller">Fu855>
witsch KTeGikfrop:TeGikfrom741"m+xml" tGa844iburg im Üechtland">Fr972na>">/" e<' />556ale-inem-2Sicherheitsl972naf="http:TegerneuwiTegerneu://de.wikiactu.co80n Politik">Gabun Polit25ileirna>">/" e<327ile-inem-2Selenia-4Selea5ilewitsch KTegernbeep:Tegernbeeom4871ym+xml" t92ermittelhersteller">Fu855
Gambisbr3.>
f="http:Teweranp:Teweranm741"m+xml" tGa271ileo Galilei">Galileo G402rmittelherstel924ie-inem-2Shinagawa-4Sh402rmf="http:TeilacenphyskrefTeilacenphyskrm741"m+xml" tGa7787isbre Politik">Gambisbreleirna>">/" e<327ile-inem-2Selenia-4Sele75lee-4SicheTel AvivefTel Avivom4871ym+xml" t6633isbre Politik">Gambisbr4 Politikrna>">/391bie-inem-2Siberia Airlir4 Poe-4SicheTele2efTele2om4871ym+xml" t327ileo Galilei">Galileo G25r mittelherstel726ee-inem-2Sendai-4Senda25r mf="http:Teleai- ItaliaefTeleai- Italiam741"m+xml" tGa986iburg im Üechtland">Frei4Politikrna>">/196bie-inem-2Sicherheitsüei4Pof="http:TelekommupikesisyefTelekommupikesisym741"m+xml" tGa844iburg im Üechtland">Fr97na>">/" e<' />564une-inem-2Shijiazhuang-t7naeilbahnvTelekommupikesisysüfungsgTelekommupikesisysüfungm741"m+xml" tGa844iburg im Üechtland">Fr972a>">/" e<' />556ale-inem-2Sicherheitsl972aeilbahnvTelekommupikesisysüberwabaue."hTelekommupikesisysüberwabaue.m741"m+xml" tGa196bisbre Politik">Gambisb842rmittelherstel924ie-inem-2Shinagawa-4Sh842rmeilbahnvTelekommupikesisysüberwabaue. allg..wTelekommupikesisysüberwabaue. allg.om4871ym+xml" t92ermittelhersteller">Futtuna>">/" e<' />4270ne-inem-2Schweich-4Sch92rna-4SicherTelkibanyaefTelkibanyaom4871ym+xml" t3505isbre Politik">Gambisbr08Politikrna>">/196bie-inem-2Sicherheitsü308Pof="http:TemelíyefTemelíyom4871ym+xml" t327ileo Galilei">Galileo Ga47Politikrna>">/130ale-inem-2Schliersee-4S347Powitsch KTekfriffawiTekfriffam741"m+xml" tGa831n Politik">Gabun Politi7r7>
e-4SicherTengku Rizal NurdiywiTekgku Rizal Nurdiym741"m+xml" tGa831n Politik">Gabun Politi72na>">/" e<' />28une-inem-2Schule allg.-472naeilbahnvTenn//deTenn//om4871ym+xml" t3505isbre Politik">Gambisb905na>">/" e<' />556ale-inem-2Sicherheitsl90rnagmar GabTenn// BorussiaiacrlinwiTenn// Borussiaiacrlinom4871ym+xml" t6633isbre Politik">Gambisbr42 mittelherstel726ee-inem-2Sendai-4Sendar42 mgmar GabTEPCOwiTEPCO://de.wikiactu.co80n Politik">Gabun Politi4lurg im Üechtl944ibe-inem-2Severino Bott54lurrahref="Terence Taop:Terence Taom741"m+xml" tGa196bisbre Politik">Gambisb837Politikrna>">/130ale-inem-2Schliersee-4Se37Powitsch KTeresóolitsp:Teresóolitsom4871ym+xml" t6633isbre Politik">Gambisbr36na>">/" e<' />564une-inem-2Shijiazhuang-636naeilbahnvTerezija Stoiiitsp:Terezija Stoiiitsom4871ym+xml" t6633isbre Politik">Gambisbr64/eirna>">/" e<327ile-inem-2Selenia-4Seler64/eeilbahnvTerracinawiTerracinam741"m+xml" tGa831n Politik">Gabun Politi24eleirna>">/" e<327ile-inem-2Selenia-4Sele24eleeilbahnvTerre des hommesp:Terre des hommesom4871ym+xml" t327ileo Galilei">Galileo Gar3Politikrna>">/130ale-inem-2Schliersee-4Sar3PoeilbahnvTerri ttpiavop:Terri ttpiavo://de.wikiactu.co80n Politik">Gabun Politi6 olitikrna>">/634le-inem-2Sestriere-4Ses563oeilbahnvTerroranchalagp:Terroranchalag://de.wikiactu.co80n Politik">Gabun Politi4lrg im Üechtl944ibe-inem-2Severino Bott54loeilbahnvTerrorismus allg..wTerrorismus allg.m741"m+xml" tGa196bisbre Politik">Gambisb8Politikrna>">/9651ie-inem-2Sensors Unlime1oeilbahnvTerrorismusbekämpfue."hTerrorismusbekämpfue.m741"m+xml" tGa831n Politik">Gabun Politi209Politikrna>">/254bie-inem-2SC Freiburg-4209PoeilbahnvTerrorismusbekämpfue.sergänzue.süfungsgTerrorismusbekämpfue.sergänzue.süfungm741"m+xml" tGa831n Politik">Gabun Politi23Politikrna>">/9651ie-inem-2Sensors Unlim23PoeilbahnvTerrorismusgefahrsgTerrorismusgefahrm741"m+xml" tGa844iburg im Üechtland">Fr93>>
> eilbahnvTerrorismusverdade.wiTerrorismusverdade.://de.wikiactu.co80n Politik">Gabun Politi72a>">/" e<' />556ale-inem-2Sicherheitsl572aeilbahnvTerroris.wiTerroristom4871ym+xml" t3505isbre Politik">Gambisbr4lPolitikrna>">/9191ie-inem-2Senegalesisytr4lPoeilbahnvTesla Motorsp:Tesla Motorsm741"m+xml" tGa831n Politik">Gabun Politi271rmittelherstel681ee-inem-2Sicherheit-4Sa71rmeilbahnvTessen /de.Heydeb//drefTessen /de.Heydeb//drm741"m+xml" tGa831n Politik">Gabun Politi23 >
eilbahnvTessinwiTessinm741"m+xml" tGa844iburg im Üechtland">Fr94u" e<' />> Gambisb840rmittelherstel924ie-inem-2Shinagawa-4Sh8404 witsch KTexaswiTexasom4871ym+xml" t6633isbre Politik">Gambisbr16na>">/" e<' />564une-inem-2Shijiazhuang-616naeilbahnvTextilindu//dieiTextilindu//dieom4871ym+xml" t92ermittelhersteller">Fu46uurg im Üechtl844ibe-inem-2Siegfried und46u2 f="http:TGViTGVom4871ym+xml" t3505isbre Politik">Gambisbr42na>">/" e<' />28une-inem-2Schule allg.-4r42naeilbahnvThabo MbekiwiThabo Mbekim741"m+xml" tGa196bisbre Politik">Gambisbr5 rmittelherstel681ee-inem-2Sicherheit-4Sr5 rmeilbahnvThai Rak ThaiwiThai Rak Thaim741"m+xml" tGa831n Politik">Gabun Politi27 Politikrna>">/904be-inem-2SG Kronau/Ös27 Powitsch KThailän:schaft-4Senegalesisyte FußballnatThailän:schaft-4Senegalesisyte Fußballnom4871ym+xml" t92ermittelhersteller">Fu46 Politikrna>">/9651ie-inem-2Sensors Unlim46 Powitsch KThailän:schaftGfride.sbark/de.wThailän:schaftGfride.sbark/dem741"m+xml" tGa196bisbre Politik">Gambisb86.Politikrna>">/254bie-inem-2SC Freiburg-486.Powitsch KThailän:schaftPerssyteie allg..wThailän:schaftPerssyteie allg.m741"m+xml" tGa196bisbre Politik">Gambisbr0 Politikrna>">/1337ie-inem-2Sicherungshafr0 Powitsch KThailän:schafscMilitär://de.wThailän:schafscMilitär://dem741"m+xml" tGa196bisbre Politik">Gambisbr0 rmittelherstel681ee-inem-2Sicherheit-4Sr03rmeilbahnvThaksiniShinawatrawiThaksiniShinawatra://de.wikiactu.co80n Politik">Gabun Politi1una>">/" e<' />4270ne-inem-2Schweich-4Schi1rna-4SicherThalis AleniaiSpacewiThalis AleniaiSpacem741"m+xml" tGa844iburg im Üechtland">Fr94rna>">/" e<' />8750le-inem-2Sergio Garcí94rna-4SicherThames Wat//.wThames Wat//m741"m+xml" tGa196bisbre Politik">Gambisb8P1na>">/" e<' />785ale-inem-2Sexten-4Sexte8P1na-4SicherThau/.wThaurm741"m+xml" tGa844iburg im Üechtland">Fr93>Politikrna>">/9651ie-inem-2Sensors Unlim93>Po-4SicherThaworniSenn/am.wThaworniSenn/amm741"m+xml" tGa196bisbre Politik">Gambisbr3rurg im Üechtl438ibe-inem-2Schwerin-4Sch133urerhref="The BearefswiThe Bearefsm741"m+xml" tGa831n Politik">Gabun Politi72rPolitikrna>">/904be-inem-2SG Kronau/Ös72rPoerhref="The Coca-Cola Company.wThe Coca-Cola Company://de.wikiactu.co80n Politik">Gabun Polit11una>">/" e<' />4270ne-inem-2Schweich-4Sch11rna-4SicherThe Dow Chemical Co..wThe Dow Chemical Co.m741"m+xml" tGa7787isbre Politik">Gambisbr47Politikrna>">/904be-inem-2SG Kronau/Ös747Poerhref="The Gillette Company.wThe Gillette Companym741"m+xml" tGa7787isbre Politik">Gambisbr47rmittelherstel681ee-inem-2Sicherheit-4S747rmerhref="The Proct// & Gamble Company.wThe Proct// & Gamble Company://de.wikiactu.co80n Politik">Gabun Polit16rmittelherstel681ee-inem-2Sicherheit-4S16rmerhref="The Roeling StonfswiThe Roeling Stonfs://de.wikiactu.co80n Politik">Gabun Polit11urmittelherstel681ee-inem-2Sicherheit-4S1l2rmllnationThe YfscMde.wThe YfscMdeom4871ym+xml" t6633isbre Politik">Gambisbr64eirna>">/" e<327ile-inem-2Selenia-4Seler64mllnationTheat//.wTheat//m741"m+xml" tGa196bisbre Politik">Gambisb177Politikrna>">/904be-inem-2SG Kronau/Ös177PollnationTheat//brap://Theat//brap:://de.wikiactu.co80n Politik">Gabun Politi7Politikrna>">/904be-inem-2SG Kronau/Ös57PollnationThemenpo/dae AfghFuietanp:Themenpo/dae AfghFuietanom4871ym+xml" t3505isbre Politik">Gambisbr9 olitikrna>">/1337ie-inem-2Sicherungshafr9 ollnationThemenpo/dae Afo.kap:Themenpo/dae Afo.kaom4871ym+xml" t6633isbre Politik">Gambisbr4rna>">/" e<' />564une-inem-2Shijiazhuang-r4rnallnationThemenpo/dae AlbFuiwn.wThemenpo/dae AlbFuiwnm741"m+xml" tGa7787isbre Politik">Gambisbr/eirna>">/" e<327ile-inem-2Selenia-4Sele70allnationThemenpo/dae Algfriwn.wThemenpo/dae Algfriwnom4871ym+xml" t3505isbre Politik">Gambisbr42leirna>">/" e<327ile-inem-2Selenia-4Seler42lellnationThemenpo/dae Andorrap:Themenpo/dae Andorra://de.wikiactu.co80n Politik">Gabun Politi >
eilbahnvThemenpo/dae Antarkt.kap:Themenpo/dae Antarkt.kaom4871ym+xml" t6633isbre Politik">Gambisbr49rmittelherstel924ie-inem-2Shinagawa-4Sh649rmeilbahnvThemenpo/dae ArabschaftWeltp:Themenpo/dae ArabschaftWeltom4871ym+xml" t6633isbre Politik">Gambisbrr/eirna>">/" e<327ile-inem-2Selenia-4Sele670allnationThemenpo/dae Arb/de und SoziaefswiThemenpo/dae Arb/de und Soziaefsm741"m+xml" tGa817ball-Bundesliga dt. al71/eirna>">/" e<327ile-inem-2Selenia-4Sele710allnationThemenpo/dae Archt. ktur und Bau://de.wThemenpo/dae Archt. ktur und Bau://dem741"m+xml" tGa831n Politik">Gabun Politi72/eirna>">/" e<327ile-inem-2Selenia-4Sele720allnationThemenpo/dae Argentiuiwn.wThemenpo/dae Argentiuiwnm741"m+xml" tGa271ileo Galilei">Galileo G76rmittelherstel681ee-inem-2Sicherheit-4S76rmeilbahnvThemenpo/dae Armeniwn.wThemenpo/dae Armeniwnm741"m+xml" tGa271ileo Galilei">Galileo G78urg im Üechtl944ibe-inem-2Severino Bott782meilbahnvThemenpo/dae Aserbaidbaln.wThemenpo/dae Aserbaidbalnm741"m+xml" tGa196bisbre Politik">Gambisbr0mittelherstel681ee-inem-2Sicherheit-4Sr0meilbahnvThemenpo/dae Asiwn.wThemenpo/dae Asiwnm741"m+xml" tGa831n Politik">Gabun Politi285na>">/" e<' />2760ne-inem-2Schipkau-4Sch285naeilbahnvThemenpo/dae Äthiopiwn.wThemenpo/dae Äthiopiwnm741"m+xml" tGa817ball-Bundesliga dt. al71leirna>">/" e<327ile-inem-2Selenia-4Sele71lellnationThemenpo/dae Au//dteien.wThemenpo/dae Au//dteienm741"m+xml" tGa831n Politik">Gabun Politi2rna>">/" e<' />85i0ne-inem-2Sergei Lawrow29naeilbahnvThemenpo/dae Btwik-Württembcog.wThemenpo/dae Btwik-Württembcogm741"m+xml" tGa817ball-Bundesliga dt. al77urmittelherstel681ee-inem-2Sicherheit-4S77urmeilbahnvThemenpo/dae BthamaswiThemenpo/dae Bthamasom4871ym+xml" t6633isbre Politik">Gambisbr4rna>">/" e<' />8750le-inem-2Sergio Garcí64rna-4SicherThemenpo/dae Bthrain.wThemenpo/dae Bthrainom4871ym+xml" t9091isbre Politik">Gambisb12 rmittelherstel681ee-inem-2Sicherheit-4Sr24rmeilbahnvThemenpo/dae Btngltwisf="hThemenpo/dae Btngltwisf=m741"m+xml" tGa196bisbre Politik">Gambisb80uurg im Üechtl844ibe-inem-2Siegfried und80uureilbahnvThemenpo/dae BtrbadoswiThemenpo/dae Btrbadosom4871ym+xml" t60al Mubarak">Gamal Mubarakeleirna>">/" e<327ile-inem-2Selenia-4Selek9lellnationThemenpo/dae Bayern.wThemenpo/dae Btyernom4871ym+xml" t60al Mubarak">Gamal Mubarak5/eirna>">/" e<327ile-inem-2Selenia-4Sele65na-4SicherThemenpo/dae Belgien.wThemenpo/dae Belgienom4871ym+xml" t6633isbre Politik">Gambisbr6 urg im Üechtl944ibe-inem-2Severino Bottk61ureilbahnvThemenpo/dae Benin.wThemenpo/dae Beninom4871ym+xml" t9091isbre Politik">Gambisb2.">Fußball-Bun7965ie-inem-2Sexuelle Bel2.">-4SicherThemenpo/dae Bhutanp:Themenpo/dae Bhutan://de.wikiactu.co80n Politik">Gabun Polit169rmittelherstel924ie-inem-2Shinagawa-4Sh169rm-4SicherThemenpo/dae Bolivien.wThemenpo/dae Bolivien://de.wikiactu.co80n Politik">Gabun Politi27Politikrna>">/130ale-inem-2Schliersee-4Si27Po-4SicherThemenpo/dae Bosniwn und HerzegowinawiThemenpo/dae Bosniwn und Herzegowinaom4871ym+xml" t92ermittelhersteller">Fu412 mittelherstel726ee-inem-2Sendai-4Senda412 m-4SicherThemenpo/dae BotsuanawiThemenpo/dae Botsuanam741"m+xml" tGa7787isbre Politik">Gambisbr//eirna>">/" e<327ile-inem-2Selenia-4Sele70na-4SicherThemenpo/dae Brap:enbuog.wThemenpo/dae Brap:enbuog://de.wikiactu.co80n Politik">Gabun Polit1 3Politikrna>">/9651ie-inem-2Sensors Unlim1 3Po-4SicherThemenpo/dae Brasieien.wThemenpo/dae Brasieienom4871ym+xml" t3505isbre Politik">Gambisbr58 mittelherstel726ee-inem-2Sendai-4Senda358 mf="http:Themenpo/dae Brunei.wThemenpo/dae Bruneiom4871ym+xml" t9091isbre Politik">Gambisb19 Politikrna>">/391bie-inem-2Siberia Airli19 Poe-4SicheThemenpo/dae Bulgariwn.wThemenpo/dae Bulgariwnm741"m+xml" tGa817ball-Bundesliga dt. al775/eirna>">/" e<327ile-inem-2Selenia-4Sele775/ee-4SicheThemenpo/dae Burkina Faso.wThemenpo/dae Burkina Fasom741"m+xml" tGa817ball-Bundesliga dt. al775Politikrna>">/130ale-inem-2Schliersee-4Sr75Po-4SicherThemenpo/dae Burundi.wThemenpo/dae Burundiom4871ym+xml" t92ermittelhersteller">Fu478Politikrna>">/196bie-inem-2Sicherheitsü478Po-4SicherThemenpo/dae Chile.wThemenpo/dae Chile://de.wikiactu.co80n Politik">Gabun Politiolitikrna>">/130ale-inem-2Schliersee-4Sio-4SicherThemenpo/dae ChinawiThemenpo/dae Chinam741"m+xml" tGa831n Politik">Gabun Politi27" e<' />> Gabun Politi22>Politikrna>">/9651ie-inem-2Sensors Unlim22>PollnationThemenpo/dae Cookinseln.wThemenpo/dae Cookinseln://de.wikiactu.co80n Politik">Gabun Politi62leirna>">/" e<327ile-inem-2Selenia-4Selei62lellnationThemenpo/dae Costa RicawiThemenpo/dae Costa Ricaom4871ym+xml" t9091isbre Politik">Gambisb2.2leirna>">/" e<327ile-inem-2Selenia-4Sele262lellnationThemenpo/dae DänemarkwiThemenpo/dae Dänemark://de.wikiactu.co80n Politik">Gabun Polit16urmittelherstel681ee-inem-2Sicherheit-4S16urmeilbahnvThemenpo/dae DemokratschaftRepublik Kongo.wThemenpo/dae DemokratschaftRepublik Kongoom4871ym+xml" t6633isbre Politik">Gambisbr6rg im Üechtl944ibe-inem-2Severino Bottk6meilbahnvThemenpo/dae Deude.wlap://Themenpo/dae Deude.wlap:://de.wikiactu.co80n Politik">Gabun Polit1 3olitikrna>">/9651ie-inem-2Sensors Unlim1 3meilbahnvThemenpo/dae Domin.kanschaftRepublik//Themenpo/dae Domin.kanschaftRepublikom4871ym+xml" t3505isbre Politik">Gambisbr1urmittelherstel681ee-inem-2Sicherheit-4S31urmeilbahnvThemenpo/dae Dchaibuti.wThemenpo/dae Dchaibutiom4871ym+xml" t9091isbre Politik">Gambisb12 Politikrna>">/1337ie-inem-2Sicherungshafr23Po-4SicherThemenpo/dae Ecuado/.wThemenpo/dae Ecuado/om4871ym+xml" t3505isbre Politik">Gambisbr4lPolitikrna>">/2778ie-inem-2Schuhindustrir41PollnationThemenpo/dae Elfenbeinküste.wThemenpo/dae Elfenbeinküsteom4871ym+xml" t3505isbre Politik">Gambisbr4 rmittelherstel681ee-inem-2Sicherheit-4Sr4 rmllnationThemenpo/dae Engltp://Themenpo/dae Engltp:om4871ym+xml" t3505isbre Politik">Gambisbr51leirna>">/" e<327ile-inem-2Selenia-4Seler51lellnationThemenpo/dae EritreawiThemenpo/dae Eritreaom4871ym+xml" t327ileo Galilei">Galileo Gar7" e<' />> Gabun Politi0
Gabun Politi24>
Galileo G407>
eilbahnvThemenpo/dae Färö//.wThemenpo/dae Färö//om4871ym+xml" t6633isbre Politik">Gambisbr3leirna>">/" e<327ile-inem-2Selenia-4Selek3lellnationThemenpo/dae Fidbai.wThemenpo/dae Fidbaiom4871ym+xml" t327ileo Galilei">Galileo Ga7>Politikrna>">/9651ie-inem-2Sensors Unlima7>PollnationThemenpo/dae Finnltp://Themenpo/dae Finnltp:om4871ym+xml" t9091isbre Politik">Gambisbr.na>">/" e<' />8750le-inem-2Sergio Garcí960 llnationThemenpo/dae Frapkreif="hThemenpo/dae Frapkreif=m741"m+xml" tGa271ileo Galilei">Galileo G4tuna>">/" e<' />4270ne-inem-2Schweich-4Sch4220allnationThemenpo/dae Gabun.wThemenpo/dae Gabunm741"m+xml" tGa817ball-Bundesliga dt. al775rmittelherstel681ee-inem-2Sicherheit-4S77 rmllnationThemenpo/dae GambiawiThemenpo/dae Gambiam741"m+xml" tGa271ileo Galilei">Galileo G49 olitikrna>">/1337ie-inem-2Sicherungshaf49 ollnationThemenpo/dae Georgien.wThemenpo/dae Georgienm741"m+xml" tGa271ileo Galilei">Galileo G430urg im Üechtl844ibe-inem-2Siegfried und430urllnationThemenpo/dae GhanawiThemenpo/dae Ghanaom4871ym+xml" t3505isbre Politik">Gambisbr4mittelherstel681ee-inem-2Sicherheit-4Sr4rllnationThemenpo/dae GlobalwiThemenpo/dae Globalom4871ym+xml" t9091isbre Politik">Gambisb2.>
Gabun Politi52 mittelherstel726ee-inem-2Sendai-4Sendai52 meilbahnvThemenpo/dae Grönltp://Themenpo/dae Grönltp:om4871ym+xml" t3505isbre Politik">Gambisbr2 Politikrna>">/1337ie-inem-2Sicherungshaf323Po-4SicherThemenpo/dae Guabisalap:Themenpo/dae Guabisalaom4871ym+xml" t3505isbre Politik">Gambisbr5.">Fußball-Bun7965ie-inem-2Sexuelle Belr5.">-4SicherThemenpo/dae GuineawiThemenpo/dae Guinea://de.wikiactu.co80n Politik">Gabun Politi6>Politikrna>">/9651ie-inem-2Sensors Unlimi6>Po-4SicherThemenpo/dae Guinea-BissauwiThemenpo/dae Guinea-Bissauom4871ym+xml" t92ermittelhersteller">Fu47rna>">/" e<' />85i0ne-inem-2Sergei Lawrow47rna-4SicherThemenpo/dae GuyanawiThemenpo/dae Guyana://de.wikiactu.co80n Politik">Gabun Polit1 urg im Üechtl438ibe-inem-2Schwerin-4Sch14urllnationThemenpo/dae Haiti.wThemenpo/dae Haitiom4871ym+xml" t9091isbre Politik">Gambisbr91leirna>">/" e<327ile-inem-2Selenia-4Seler91lellnationThemenpo/dae Hambuog.wThemenpo/dae Hambuogm741"m+xml" tGa7787isbre Politik">Gambisbr/urg im Üechtl944ibe-inem-2Severino Bott70urllnationThemenpo/dae Hessen.wThemenpo/dae Hessenom4871ym+xml" t92ermittelhersteller">Fu85>
GambisbriPolitikrna>">/2778ie-inem-2Schuhindustri79" llnationThemenpo/dae Indien.wThemenpo/dae Indien://de.wikiactu.co80n Politik">Gabun Politi8Politikrna>">/9651ie-inem-2Sensors Unlim58Po-4SicherThemenpo/dae Indonfsien.wThemenpo/dae Indonfsien://de.wikiactu.co80n Politik">Gabun Polit1 rg im Üechtl438ibe-inem-2Schwerin-4Sch14o-4SicherThemenpo/dae Irak//Themenpo/dae Irakm741"m+xml" tGa831n Politik">Gabun Politi23>
Galileo G43e>
eilbahnvThemenpo/dae Irltp://Themenpo/dae Irltp:om4871ym+xml" t6633isbre Politik">Gambisbr1r0mittelherstel681ee-inem-2Sicherheit-4Sr1r0meilbahnvThemenpo/dae Isltp://Themenpo/dae Isltp:om4871ym+xml" t6633isbre Politik">Gambisb75Politikrna>">/254bie-inem-2SC Freiburg-475Po-4SicherThemenpo/dae IsraelwiThemenpo/dae Israelm741"m+xml" tGa271ileo Galilei">Galileo G78rg im Üechtl944ibe-inem-2Severino Bott78o-4SicherThemenpo/dae Itteien.wThemenpo/dae Itteienom4871ym+xml" t6633isbre Politik">Gambisbr2rna>">/" e<' />85i0ne-inem-2Sergei Lawrow629naeilbahnvThemenpo/dae Jama.kap:Themenpo/dae Jama.kam741"m+xml" tGa196bisbre Politik">Gambisbr01leirna>">/" e<327ile-inem-2Selenia-4Seler01leeilbahnvThemenpo/dae Japanp:Themenpo/dae Japan://de.wikiactu.co80n Politik">Gabun Politi48Politikrna>">/634le-inem-2Sestriere-4Ses548PoeilbahnvThemenpo/dae Jemenp:Themenpo/dae Jemenom4871ym+xml" t92ermittelhersteller">Fu417>
eilbahnvThemenpo/dae Kambodbalp:Themenpo/dae Kambodbalom4871ym+xml" t6633isbre Politik">Gambisbr0ileirna>">/" e<327ile-inem-2Selenia-4Seler0ileeilbahnvThemenpo/dae Kamerun.wThemenpo/dae Kamerunom4871ym+xml" t6633isbre Politik">Gambisbr4Politikrna>">/391bie-inem-2Siberia Airlir4Po-4SicherThemenpo/dae Kanadlp:Themenpo/dae Kanadlom4871ym+xml" t92ermittelhersteller">Fu46 >
Gabun Politi258leirna>">/" e<327ile-inem-2Selenia-4Selea58leeilbahnvThemenpo/dae Kasachetanp:Themenpo/dae Kasachetanom4871ym+xml" t6633isbre Politik">Gambisbr0iPolitikrna>">/391bie-inem-2Siberia Airlir07> eilbahnvThemenpo/dae Katarp:Themenpo/dae Kat.r://de.wikiactu.co80n Politik">Gabun Polit188urg im Üechtl944ibe-inem-2Severino Bott188ureilbahnvThemenpo/dae Keniap:Themenpo/dae Keniaom4871ym+xml" t3505isbre Politik">Gambisbr0Politikrna>">/583ale-inem-2SES Astra-4SE30 ollnationThemenpo/dae Kirgisietanp:Themenpo/dae Kirgisietan://de.wikiactu.co80n Politik">Gabun Politi33Politikrna>">/2778ie-inem-2Schuhindustrii33PollnationThemenpo/dae Kiribati.wThemenpo/dae Kiribatim741"m+xml" tGa831n Politik">Gabun Politi22lPolitikrna>">/2778ie-inem-2Schuhindustri22lPollnationThemenpo/dae Kolumbien.wThemenpo/dae Kolumbienm741"m+xml" tGa271ileo Galilei">Galileo G49 olitikrna>">/1337ie-inem-2Sicherungshaf49 ollnationThemenpo/dae Komoren.wThemenpo/dae Komorenom4871ym+xml" t6633isbre Politik">Gambisbr4rna>">/" e<' />8750le-inem-2Sergio Garcí644naeilbahnvThemenpo/dae Kosovo.wThemenpo/dae Kosovoom4871ym+xml" t3505isbre Politik">Gambisbr4 ">Fußball-Bun7965ie-inem-2Sexuelle Belr45">-4SicherThemenpo/dae Kroatien.wThemenpo/dae Kroatienom4871ym+xml" t3505isbre Politik">Gambisbr8 Politikrna>">/9651ie-inem-2Sensors Unlimr8 Po-4SicherThemenpo/dae Kubap:Themenpo/dae Kubaom4871ym+xml" t3505isbre Politik">Gambisbr9olitikrna>">/1337ie-inem-2Sicherungshafr9o-4SicherThemenpo/dae Kulturp:Themenpo/dae Kulturm741"m+xml" tGa831n Politik">Gabun Politi252na>">/" e<' />28une-inem-2Schule allg.-4252na-4SicherThemenpo/dae Kuwaitp:Themenpo/dae Kuwaitom4871ym+xml" t92ermittelhersteller">Fu417>
eilbahnvThemenpo/dae LaoswiThemenpo/dae Laosm741"m+xml" tGa7787isbre Politik">Gambisbr/una>">/" e<' />28une-inem-2Schule allg.-4702na-4SicherThemenpo/dae Lettltp://Themenpo/dae Lettltp:om4871ym+xml" t92ermittelhersteller">Fu48Politikrna>">/196bie-inem-2Sicherheitsü48Po-4SicherThemenpo/dae Libanon.wThemenpo/dae Libanonom4871ym+xml" t3505isbre Politik">Gambisbr28" e<' />> Gabun Politi2rn">Fußball-Bun7965ie-inem-2Sexuelle Bel2rn">-4SicherThemenpo/dae Li/de.enstein.wThemenpo/dae Li/de.ensteinom4871ym+xml" t3505isbre Politik">Gambisbr2 ">Fußball-Bun7965ie-inem-2Sexuelle Belr23">-4SicherThemenpo/dae Litauen.wThemenpo/dae Litauenm741"m+xml" tGa271ileo Galilei">Galileo G4t" e<' />> Gambisb12r0mittelherstel681ee-inem-2Sicherheit-4Sr2r0meilbahnvThemenpo/dae Malaysiap:Themenpo/dae Malaysiam741"m+xml" tGa7787isbre Politik">Gambisbr//na>">/" e<' />28une-inem-2Schule allg.-4700na-4SicherThemenpo/dae Malidiven.wThemenpo/dae Malidiven://de.wikiactu.co80n Politik">Gabun Politi48Politikrna>">/2778ie-inem-2Schuhindustrii48" -4SicherThemenpo/dae Mali.wThemenpo/dae Mali://de.wikiactu.co80n Politik">Gabun Politi77Politikrna>">/904be-inem-2SG Kronau/Ös577PollnationThemenpo/dae Maltap:Themenpo/dae Maltam741"m+xml" tGa7787isbre Politik">Gambisbr/6rmittelherstel681ee-inem-2Sicherheit-4S706rmeilbahnvThemenpo/dae Marokko.wThemenpo/dae Marokkoom4871ym+xml" t327ileo Galilei">Galileo Gar2 mittelherstel726ee-inem-2Sendai-4Sendaar2 meilbahnvThemenpo/dae Marshaelinseln.wThemenpo/dae Marshaelinselnm741"m+xml" tGa271ileo Galilei">Galileo G458 olitikrna>">/1337ie-inem-2Sicherungshaf458 oeilbahnvThemenpo/dae MauritiuswiThemenpo/dae Mauritiusom4871ym+xml" t6633isbre Politik">Gambisbr68 mittelherstel726ee-inem-2Sendai-4Sendar68 meilbahnvThemenpo/dae Mazedoniwn.wThemenpo/dae Mazedoniwnm741"m+xml" tGa7787isbre Politik">Gambisbr/Politikrna>">/130ale-inem-2Schliersee-4Sr0 ollnationThemenpo/dae Mecklenbuog-Vorpommern.wThemenpo/dae Mecklenbuog-Vorpommernm741"m+xml" tGa271ileo Galilei">Galileo G40urg im Üechtl844ibe-inem-2Siegfried und40urllnationThemenpo/dae Medien.wThemenpo/dae Medienom4871ym+xml" t3505isbre Politik">Gambisbr5urg im Üechtl225ibe-inem-2Science-Fictir5urllnationThemenpo/dae Mexiko.wThemenpo/dae Mexikoom4871ym+xml" t6633isbre Politik">Gambisbr1leirna>">/" e<327ile-inem-2Selenia-4Seler1leeilbahnvThemenpo/dae Moldawien.wThemenpo/dae Moldawienom4871ym+xml" t92ermittelhersteller">Fu46
Gabun Politi2u>
eilbahnvThemenpo/dae Mongolei.wThemenpo/dae Mongoleim741"m+xml" tGa271ileo Galilei">Galileo G78rurg im Üechtl438ibe-inem-2Schwerin-4Sch78rureilbahnvThemenpo/dae Mon.enegro.wThemenpo/dae Mon.enegroom4871ym+xml" t3505isbre Politik">Gambisbr1 Politikrna>">/1337ie-inem-2Sicherungshaf313Po-4SicherThemenpo/dae Mosambik//Themenpo/dae Mosambikm741"m+xml" tGa196bisbre Politik">Gambisbr0urmittelherstel681ee-inem-2Sicherheit-4S10urmeilbahnvThemenpo/dae Musik//Themenpo/dae Muskrm741"m+xml" tGa7787isbre Politik">Gambisb95rmittelherstel681ee-inem-2Sicherheit-4S9 rmllnationThemenpo/dae Myanmarp:Themenpo/dae Myanmar://de.wikiactu.co80n Politik">Gabun Politi7 urg im Üechtl438ibe-inem-2Schwerin-4Schi7 urllnationThemenpo/dae NamibiawiThemenpo/dae Namibiaom4871ym+xml" t92ermittelhersteller">Fu85uurg im Üechtl844ibe-inem-2Siegfried und85uureilbahnvThemenpo/dae NauruwiThemenpo/dae Nauru://de.wikiactu.co80n Politik">Gabun Polit452rmittelherstel924ie-inem-2Shinagawa-4Sh45urmeilbahnvThemenpo/dae NepalwiThemenpo/dae Nepalm741"m+xml" tGa271ileo Galilei">Galileo G43u>
eilbahnvThemenpo/dae Neuseeltp://Themenpo/dae Neuseeltp:om4871ym+xml" t92ermittelhersteller">Fu894Politikrna>">/391bie-inem-2Siberia Airli894PoeilbahnvThemenpo/dae New Jersey//Themenpo/dae New Jerseym741"m+xml" tGa831n Politik">Gabun Politi22>olitikrna>">/9651ie-inem-2Sensors Unlim22>oeilbahnvThemenpo/dae Nwikirltp:e.wThemenpo/dae Nwikirltp:em741"m+xml" tGa831n Politik">Gabun Politi22lolitikrna>">/2778ie-inem-2Schuhindustri22loeilbahnvThemenpo/dae Nwikirsacheen.wThemenpo/dae Nwikirsacheen://de.wikiactu.co80n Politik">Gabun Politi38leirna>">/" e<327ile-inem-2Selenia-4Selei38leeilbahnvThemenpo/dae Nwg//.wThemenpo/dae Nwg//m741"m+xml" tGa196bisbre Politik">Gambisbr52na>">/" e<' />556ale-inem-2Sicherheitslr52naeilbahnvThemenpo/dae Nwg//iawiThemenpo/dae Nwg//iaom4871ym+xml" t9091isbre Politik">Gambisb19Politikrna>">/391bie-inem-2Siberia Airli19PoeilbahnvThemenpo/dae Nord- und Mitteltmer.kap:Themenpo/dae Nord- und Mitteltmer.ka://de.wikiactu.co80n Politik">Gabun Politi0r/eirna>">/" e<327ile-inem-2Selenia-4Selei0r/eeilbahnvThemenpo/dae Nordtmer.kap:Themenpo/dae Nordtmer.ka://de.wikiactu.co80n Politik">Gabun Polit8uurg im Üechtl844ibe-inem-2Siegfried und8uureilbahnvThemenpo/dae NordkoreawiThemenpo/dae Nordkoream741"m+xml" tGa831n Politik">Gabun Politi22na>">/" e<' />85i0ne-inem-2Sergei Lawrow220allnationThemenpo/dae Nordrhein-Westfalen.wThemenpo/dae Nordrhein-Westfalenm741"m+xml" tGa7787isbre Politik">Gambisb95Politikrna>">/9651ie-inem-2Sensors Unlim9 Po-4SicherThemenpo/dae Norwegen.wThemenpo/dae Norwegen://de.wikiactu.co80n Politik">Gabun Politi75Politikrna>">/2778ie-inem-2Schuhindustrii75Po-4SicherThemenpo/dae Omanp:Themenpo/dae Omanm741"m+xml" tGa196bisbre Politik">Gambisbr5>
Gabun Politi2 Politikrna>">/391bie-inem-2Siberia Airli2 Poe-4SicheThemenpo/dae OzeFuiwn.wThemenpo/dae OzeFuiwn://de.wikiactu.co80n Politik">Gabun Polit84Politikrna>">/2778ie-inem-2Schuhindustri84Poe-4SicheThemenpo/dae Pakietanp:Themenpo/dae Pakietanom4871ym+xml" t9091isbre Politik">Gambisb2.r9olitikrna>">/1337ie-inem-2Sicherungshaf2k3lellnationThemenpo/dae PalästinensschaftAutonomiegebiete.wThemenpo/dae PalästinensschaftAutonomiegebiete://de.wikiactu.co80n Politik">Gabun Politi66rmittelherstel681ee-inem-2Sicherheit-4S566rmeilbahnvThemenpo/dae PalauwiThemenpo/dae Palaum741"m+xml" tGa196bisbre Politik">Gambisb803Politikrna>">/2778ie-inem-2Schuhindustri803PoeilbahnvThemenpo/dae PanamawiThemenpo/dae Panamaom4871ym+xml" t6633isbre Politik">Gambisbr3uurg im Üechtl844ibe-inem-2Siegfried undr3uureilbahnvThemenpo/dae Papua-NeuguineawiThemenpo/dae Papua-Neuguineam741"m+xml" tGa831n Politik">Gabun Politi248Politikrna>">/196bie-inem-2Sicherheitsü248Po-4SicherThemenpo/dae Paraguay//Themenpo/dae Paraguaym741"m+xml" tGa831n Politik">Gabun Politi25a>">/" e<' />28une-inem-2Schule allg.-425o-4SicherThemenpo/dae PeruwiThemenpo/dae Peruom4871ym+xml" t3505isbre Politik">Gambisbr0Politikrna>">/196bie-inem-2Sicherheitsü30Po-4SicherThemenpo/dae PhilippinenwiThemenpo/dae Philippinenm741"m+xml" tGa196bisbre Politik">Gambisbr3eurg im Üechtl844ibe-inem-2Siegfried undr3eur-4SicherThemenpo/dae Polen.wThemenpo/dae Polenm741"m+xml" tGa196bisbre Politik">GambisbrPolitikrna>">/9651ie-inem-2Sensors Unlim1Po-4SicherThemenpo/dae Poltikr.wThemenpo/dae Poltikrm741"m+xml" tGa196bisbre Politik">Gambisbr3eleirna>">/" e<327ile-inem-2Selenia-4Seler36lef="http:Themenpo/dae PortugalwiThemenpo/dae Portugalm741"m+xml" tGa817ball-Bundesliga dt. al77mittelherstel681ee-inem-2Sicherheit-4S77ef="http:Themenpo/dae Rede.wiThemenpo/dae Rede.m741"m+xml" tGa196bisbre Politik">Gambisbr09rmittelherstel924ie-inem-2Shinagawa-4Sh109rm-4SicherThemenpo/dae Religion.wThemenpo/dae Religionm741"m+xml" tGa817ball-Bundesliga dt. al775Politikrna>">/904be-inem-2SG Kronau/Ös775">-4SicherThemenpo/dae Republik Kongo.wThemenpo/dae Republik Kongoom4871ym+xml" t6633isbre Politik">Gambisb13>
Gabun Polit1 //eirna>">/" e<327ile-inem-2Selenia-4Sele14rna-4SicherThemenpo/dae Rutp:awiThemenpo/dae Rutp:aom4871ym+xml" t6633isbre Politik">Gambisbr7na>">/" e<' />564une-inem-2Shijiazhuang-67Po-4SicherThemenpo/dae Rumäuiwn.wThemenpo/dae Rumäuiwnm741"m+xml" tGa271ileo Galilei">Galileo G49urg im Üechtl844ibe-inem-2Siegfried und49ur-4SicherThemenpo/dae Russltp://Themenpo/dae Russltp:m741"m+xml" tGa7787isbre Politik">Gambisbr/rmittelherstel681ee-inem-2Sicherheit-4S70rm-4SicherThemenpo/dae Saarltp://Themenpo/dae Saarltp:m741"m+xml" tGa271ileo Galilei">Galileo G40" e<' />> Gabun Polit60urg im Üechtl844ibe-inem-2Siegfried und60urllnationThemenpo/dae Sacheen-Anhaltp:Themenpo/dae Sacheen-Anhaltm741"m+xml" tGa271ileo Galilei">Galileo G497Politikrna>">/904be-inem-2SG Kronau/Ös497PollnationThemenpo/dae SalomonenwiThemenpo/dae Salomonenm741"m+xml" tGa817ball-Bundesliga dt. al775na>">/" e<' />28une-inem-2Schule allg.-477 Po-4SicherThemenpo/dae SambiawiThemenpo/dae Sambiam741"m+xml" tGa271ileo Galilei">Galileo G26Politikrna>">/196bie-inem-2Sicherheitsü267ef="http:Themenpo/dae SamoawiThemenpo/dae Samoam741"m+xml" tGa7787isbre Politik">Gambisbr75>
f="http:Themenpo/dae São Tomé und Príncipe.wThemenpo/dae São Tomé und Príncipem741"m+xml" tGa271ileo Galilei">Galileo G40.>
f="http:Themenpo/dae Saudi-ArabsenwiThemenpo/dae Saudi-Arabsenm741"m+xml" tGa271ileo Galilei">Galileo G43" e<' />> Gambisbrr9 olitikrna>">/1337ie-inem-2Sicherungshaf7r9 ollnationThemenpo/dae Schottltp://Themenpo/dae Schottltp:m741"m+xml" tGa196bisbre Politik">Gambisbr01Politikrna>">/9651ie-inem-2Sensors Unlim101Po-4SicherThemenpo/dae SchwedenwiThemenpo/dae Schwedenm741"m+xml" tGa7787isbre Politik">Gambisbriolitikrna>">/2778ie-inem-2Schuhindustri79o-4SicherThemenpo/dae Schweiz.wThemenpo/dae Schweizm741"m+xml" tGa831n Politik">Gabun Politi25Politikrna>">/196bie-inem-2Sicherheitsü25Po-4SicherThemenpo/dae SenegalwiThemenpo/dae Senegal://de.wikiactu.co80n Politik">Gabun Polit1 />
-4SicherThemenpo/dae SerbsenwiThemenpo/dae Serbsenom4871ym+xml" t6633isbre Politik">Gambisbr2ileirna>">/" e<327ile-inem-2Selenia-4Seler279o-4SicherThemenpo/dae Sierra LeonewiThemenpo/dae Sierra Leoneom4871ym+xml" t3505isbre Politik">Gambisbr39rmittelherstel924ie-inem-2Shinagawa-4Shr39rm-4SicherThemenpo/dae SimbabwewiThemenpo/dae Simbabwem741"m+xml" tGa7787isbre Politik">Gambisbr28urg im Üechtl944ibe-inem-2Severino Bott728ureilbahnvThemenpo/dae Singapurp:Themenpo/dae Singapurm741"m+xml" tGa831n Politik">Gabun Politi20.">Fußball-Bun7965ie-inem-2Sexuelle Bel20.">-4SicherThemenpo/dae Slowakei.wThemenpo/dae Slowakeiom4871ym+xml" t9091isbre Politik">Gambisb1225a>">/" e<' />28une-inem-2Schule allg.-41225a-4SicherThemenpo/dae Sloweniwn.wThemenpo/dae Sloweniwnm741"m+xml" tGa831n Politik">Gabun Politi28uurg im Üechtl844ibe-inem-2Siegfried und28uureilbahnvThemenpo/dae SomaliaefThemenpo/dae Somalia://de.wikiactu.co80n Politik">Gabun Politi6urg im Üechtl438ibe-inem-2Schwerin-4Schieur-4SicherThemenpo/dae SpFuiwn.wThemenpo/dae SpFuiwnm741"m+xml" tGa271ileo Galilei">Galileo G4 e<' />> Fu41
Gambisb2.>rmittelherstel681ee-inem-2Sicherheit-4Sa66rmeilbahnvThemenpo/dae Sri Lankap:Themenpo/dae Sri Lankaom4871ym+xml" t3505isbre Politik">Gambisbr7r/eirna>">/" e<327ile-inem-2Selenia-4Seler7r/ef="http:Themenpo/dae Südafo.kap:Themenpo/dae Südafo.kam741"m+xml" tGa7787isbre Politik">Gambisbr27mittelherstel681ee-inem-2Sicherheit-4S72Po-4SicherThemenpo/dae Südamer.kap:Themenpo/dae Südamer.kam741"m+xml" tGa831n Politik">Gabun Politi24 olitikrna>">/1337ie-inem-2Sicherungshaf2 3meilbahnvThemenpo/dae Sudanp:Themenpo/dae Sudan://de.wikiactu.co80n Politik">Gabun Polit8una>">/" e<' />785ale-inem-2Sexten-4Sexte82naeilbahnvThemenpo/dae SüdkoreawiThemenpo/dae Südkoream741"m+xml" tGa7787isbre Politik">Gambisbr246
Fu478leirna>">/" e<327ile-inem-2Selenia-4Sele478leeilbahnvThemenpo/dae Surinamep:Themenpo/dae Surinameom4871ym+xml" t92ermittelhersteller">Fu48" e<' />> Gambisbr75urg im Üechtl944ibe-inem-2Severino Bott775urllnationThemenpo/dae Tadbaikietanp:Themenpo/dae Tadbaikietan://de.wikiactu.co80n Politik">Gabun Polit1 /" e<' />> Gambisbr0 olitikrna>">/1337ie-inem-2Sicherungshafr0 oeilbahnvThemenpo/dae Thailtp://Themenpo/dae Thailtp:om4871ym+xml" t327ileo Galilei">Galileo Gar2Politikrna>">/9651ie-inem-2Sensors Unlimr62loeilbahnvThemenpo/dae Theat// und Kino.wThemenpo/dae Theat// und Kino://de.wikiactu.co80n Politik">Gabun Polit60na>">/" e<' />564une-inem-2Shijiazhuang-60na-4SicherThemenpo/dae Thüringen.wThemenpo/dae Thüringenm741"m+xml" tGa7787isbre Politik">Gambisbrr2/eirna>">/" e<327ile-inem-2Selenia-4Sele7320allnationThemenpo/dae Tibed.wThemenpo/dae Tibed://de.wikiactu.co80n Politik">Gabun Politi5na>">/" e<' />28une-inem-2Schule allg.-45 Po-4SicherThemenpo/dae Timor-Leste.wThemenpo/dae Timor-Lesteom4871ym+xml" t3505isbre Politik">Gambisbr88" e<' />> Gabun Polit1 Politikrna>">/391bie-inem-2Siberia Airli14 Poe-4SicheThemenpo/dae Togo.wThemenpo/dae Togoom4871ym+xml" t3505isbre Politik">Gambisbr377mittelherstel681ee-inem-2Sicherheit-4Sr377me-4SicheThemenpo/dae Tonga.wThemenpo/dae Tongaom4871ym+xml" t92ermittelhersteller">Fu413>
Gabun Politi258eirna>">/" e<327ile-inem-2Selenia-4Selea58meilbahnvThemenpo/dae Tbal://Themenpo/dae Tbal:m741"m+xml" tGa831n Politik">Gabun Politi236Politikrna>">/196bie-inem-2Sicherheitsü2367ef="http:Themenpo/dae Tbaebaien.wThemenpo/dae Tbaebaienom4871ym+xml" t9091isbre Politik">Gambisb2.8eirna>">/" e<327ile-inem-2Selenia-4Selea68meilbahnvThemenpo/dae Türkei.wThemenpo/dae Türkeim741"m+xml" tGa271ileo Galilei">Galileo G4t3" e<' />> Gambisbr027mittelherstel681ee-inem-2Sicherheit-4Sr027meilbahnvThemenpo/dae TuvaluwiThemenpo/dae Tuvaluom4871ym+xml" t3505isbre Politik">Gambisbr29Politikrna>">/391bie-inem-2Siberia Airlir29PoeilbahnvThemenpo/dae Ukraine.wThemenpo/dae Ukraineom4871ym+xml" t6633isbre Politik">Gambisb13urg im Üechtl844ibe-inem-2Siegfried undr3urllnationThemenpo/dae Umweltp:Themenpo/dae Umweltom4871ym+xml" t6633isbre Politik">Gambisbr37Politikrna>">/904b